BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0686 (600 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10387| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_5526| Best HMM Match : zf-C3HC4 (HMM E-Value=2) 28 6.6 SB_44616| Best HMM Match : rve (HMM E-Value=0.012) 27 8.8 SB_17347| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 >SB_10387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 597 Score = 28.7 bits (61), Expect = 3.8 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +3 Query: 411 EDIVIKLGHPEVYVHQGACEHVFTFSEVXCVT 506 +D V + HP VY C+HVF F C++ Sbjct: 152 DDNVNRYKHPPVYNKSCTCKHVFWFKTHGCLS 183 >SB_5526| Best HMM Match : zf-C3HC4 (HMM E-Value=2) Length = 106 Score = 27.9 bits (59), Expect = 6.6 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 438 PEVYVHQGACEHVFTF 485 P HQGACEHVF + Sbjct: 87 PPTAPHQGACEHVFCY 102 >SB_44616| Best HMM Match : rve (HMM E-Value=0.012) Length = 1189 Score = 27.5 bits (58), Expect = 8.8 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = -3 Query: 406 LTEHMSWXGKSPIPFRRAHVRMTALLSTHPSLVST*NVLF 287 L E +SW SP PF R H T + + +LVS + F Sbjct: 600 LVEQLSWF--SPTPFCRGHANNTVVDNVGRNLVSRLKITF 637 >SB_17347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = +3 Query: 258 EVFPSGFLFINNTFYVDTRE-GCVDNSA 338 ++ SGF FI FY D R+ C D SA Sbjct: 1 DICKSGFFFIEEVFYNDMRDPSCKDYSA 28 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,496,149 Number of Sequences: 59808 Number of extensions: 267565 Number of successful extensions: 644 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 608 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 644 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1451595000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -