BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0685 (399 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1177 + 35147036-35147038,35147128-35147220,35147322-351474... 130 5e-31 11_01_0658 + 5342508-5343602,5343697-5343764,5343994-5344042,534... 27 5.5 08_02_1601 - 28138206-28138597,28138928-28139054,28139150-281399... 27 5.5 02_04_0433 - 22891261-22891509,22892181-22892301,22892405-228924... 27 5.5 05_01_0554 + 4856131-4856605,4858051-4858098,4860611-4860792,486... 27 7.2 01_01_1184 - 9430623-9430658,9430945-9431013,9431104-9431270,943... 26 9.5 >01_06_1177 + 35147036-35147038,35147128-35147220,35147322-35147406, 35147588-35147760 Length = 117 Score = 130 bits (313), Expect = 5e-31 Identities = 57/96 (59%), Positives = 77/96 (80%) Frame = +3 Query: 48 RGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYPMFQLPKLYAKLHYC 227 RGHVK +RC+NCA+C PKDKAIK+F +RNIVE AA+RD+ +A V+ + LPKLYAK+H+C Sbjct: 15 RGHVKYIRCSNCAKCCPKDKAIKRFQVRNIVEQAAIRDVQEACVHDGYVLPKLYAKVHHC 74 Query: 228 VSCAIHSKVVRNRSKKDRRIRTPPKSNFPRDMSRPQ 335 VSCAIH+ +VR RS+++RR R PP+ F R + P+ Sbjct: 75 VSCAIHAHIVRVRSRENRRDRRPPE-RFRRRVPDPR 109 Score = 29.1 bits (62), Expect = 1.4 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +2 Query: 5 MTRKRRNGGRAKHG 46 MT KRRNGGR KHG Sbjct: 1 MTFKRRNGGRNKHG 14 >11_01_0658 + 5342508-5343602,5343697-5343764,5343994-5344042, 5344217-5344333,5344438-5344506,5344631-5344725, 5345580-5345658,5346499-5346563,5347368-5347461, 5347675-5347744,5348363-5349357 Length = 931 Score = 27.1 bits (57), Expect = 5.5 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +2 Query: 239 HPQQSCQEQIEERQKNPYSSQE 304 +PQQS Q+Q EE+Q P SS + Sbjct: 616 NPQQSQQQQPEEQQSIPQSSNQ 637 >08_02_1601 - 28138206-28138597,28138928-28139054,28139150-28139914, 28140714-28140929,28141433-28141903 Length = 656 Score = 27.1 bits (57), Expect = 5.5 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = -2 Query: 173 GIVNISDRRRFYDVPNHELFDSLVLWHAPRAVCASHSFN 57 GI + D +YD + LF+ L+ P A +SH+F+ Sbjct: 439 GIDMVDDGMPYYDAMDDNLFNDLLSSVQPSAGSSSHAFS 477 >02_04_0433 - 22891261-22891509,22892181-22892301,22892405-22892496, 22892692-22892755,22892855-22892920,22893102-22893193, 22893991-22894050,22894181-22894270,22894484-22894613, 22895066-22895157,22895299-22895373,22895663-22895754, 22896496-22896586,22897541-22897574,22897745-22897791, 22899110-22899209,22899300-22899436,22900837-22901015, 22901146-22901188,22901264-22901297,22901839-22901948, 22902043-22902224,22903062-22903168,22903266-22903480 Length = 833 Score = 27.1 bits (57), Expect = 5.5 Identities = 10/39 (25%), Positives = 18/39 (46%) Frame = +1 Query: 226 ACHAPSTAKLSGTDRRKTEESVLLPRVTSLGTCHVHRQC 342 ACH ++ G+D +K + +P + +C H C Sbjct: 705 ACHVDYNEEIRGSDEKKPAANKFIPSSQRVVSCAAHPFC 743 >05_01_0554 + 4856131-4856605,4858051-4858098,4860611-4860792, 4861409-4863136 Length = 810 Score = 26.6 bits (56), Expect = 7.2 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -2 Query: 155 DRRRFYDVPNHELFD 111 DR FYD PN+E FD Sbjct: 354 DRTLFYDEPNYEAFD 368 >01_01_1184 - 9430623-9430658,9430945-9431013,9431104-9431270, 9431596-9431693,9431790-9431929,9432911-9433120, 9434314-9434832 Length = 412 Score = 26.2 bits (55), Expect = 9.5 Identities = 18/66 (27%), Positives = 26/66 (39%), Gaps = 4/66 (6%) Frame = -2 Query: 188 HWVYRGI---VNISDRRR-FYDVPNHELFDSLVLWHAPRAVCASHSFNVTTXHAWRVLHY 21 H + RG+ V D RR VPN + + R + +H +A + H Sbjct: 302 HRLMRGVWTNVRFGDMRRALAAVPNQRFVPFIFMAACERLILLNHDPRELRDYAALLYHC 361 Query: 20 GAYESC 3 G YE C Sbjct: 362 GYYEDC 367 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,620,223 Number of Sequences: 37544 Number of extensions: 177987 Number of successful extensions: 446 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 442 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 446 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 682720236 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -