BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0683 (678 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000D5715D Cluster: PREDICTED: similar to CG13643-PA... 34 2.8 UniRef50_A0US61 Cluster: Putative uncharacterized protein; n=1; ... 33 6.4 UniRef50_UPI000023CA70 Cluster: hypothetical protein FG01071.1; ... 33 8.4 UniRef50_A6S4T6 Cluster: Putative uncharacterized protein; n=2; ... 33 8.4 >UniRef50_UPI0000D5715D Cluster: PREDICTED: similar to CG13643-PA; n=1; Tribolium castaneum|Rep: PREDICTED: similar to CG13643-PA - Tribolium castaneum Length = 815 Score = 34.3 bits (75), Expect = 2.8 Identities = 21/57 (36%), Positives = 27/57 (47%) Frame = +1 Query: 505 APANNYDESGEDDGQYRPPQGEDDGLYRPELYDRELLSGAHSLNIAASGNRLPEERK 675 A +N +DE+ DDG Y P +D E L AHS NIA+S N + K Sbjct: 693 ARSNRFDETQYDDGSYNPKYDRNDD---------EFLKTAHSQNIASSRNEYSKSTK 740 >UniRef50_A0US61 Cluster: Putative uncharacterized protein; n=1; Burkholderia multivorans ATCC 17616|Rep: Putative uncharacterized protein - Burkholderia multivorans ATCC 17616 Length = 455 Score = 33.1 bits (72), Expect = 6.4 Identities = 23/48 (47%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +1 Query: 58 AAPKVNKKQGLVELYNNEGQSTAGYNLQNDNRS-FKVRNGFNVDEAPR 198 A PK N+K GL L+ + GQ TAGY + N+NRS F+V N A R Sbjct: 246 AGPK-NEKAGL--LFESAGQRTAGYYVFNENRSLFEVLLHANHGSAQR 290 >UniRef50_UPI000023CA70 Cluster: hypothetical protein FG01071.1; n=1; Gibberella zeae PH-1|Rep: hypothetical protein FG01071.1 - Gibberella zeae PH-1 Length = 2360 Score = 32.7 bits (71), Expect = 8.4 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +1 Query: 448 PEPPANLNKVAYNTNIGFNAPANNYDESGED-DGQYRPPQGED 573 P PP +N V+ T+ +A YD S DG YRPP D Sbjct: 1390 PTPPLLVNNVSMRTSPPSSASRLGYDPSNSAYDGGYRPPSAND 1432 >UniRef50_A6S4T6 Cluster: Putative uncharacterized protein; n=2; Sclerotiniaceae|Rep: Putative uncharacterized protein - Botryotinia fuckeliana B05.10 Length = 727 Score = 32.7 bits (71), Expect = 8.4 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +1 Query: 442 YRPEPPAN-LNKVAYNTNIGFNAPANNYDESGEDDGQYRPPQ 564 Y P PA + + + G N P NNY + + GQ+ PPQ Sbjct: 166 YNPHNPAPYIGPPSGSQGPGHNGPPNNYPQQWQQQGQHGPPQ 207 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.307 0.128 0.370 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 587,269,761 Number of Sequences: 1657284 Number of extensions: 10891266 Number of successful extensions: 23104 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 21870 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23072 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 52479343733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.6 bits)
- SilkBase 1999-2023 -