BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0683 (678 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z99281-26|CAE18029.1| 377|Caenorhabditis elegans Hypothetical p... 28 5.3 AC024801-8|AAK95893.1| 285|Caenorhabditis elegans Hypothetical ... 27 9.3 >Z99281-26|CAE18029.1| 377|Caenorhabditis elegans Hypothetical protein Y57G11C.46 protein. Length = 377 Score = 28.3 bits (60), Expect = 5.3 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -3 Query: 661 AICYHWLQYSKNALQTEAL 605 +ICYHW +SKN + T + Sbjct: 181 SICYHWSDFSKNRVCTHCI 199 >AC024801-8|AAK95893.1| 285|Caenorhabditis elegans Hypothetical protein Y50D7A.9 protein. Length = 285 Score = 27.5 bits (58), Expect = 9.3 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = -1 Query: 675 FSFFRQSVTTGCNIQRMRSRQKLSVIQ-LRSIQAVVF 568 FS R+ TTG +Q+++ QKL Q R++ VF Sbjct: 2 FSPLRRLTTTGLQLQKLQKLQKLQQFQPARAVHLTVF 38 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.307 0.128 0.370 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,878,806 Number of Sequences: 27780 Number of extensions: 268160 Number of successful extensions: 690 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 673 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 690 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1539654388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.6 bits)
- SilkBase 1999-2023 -