BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0680 (700 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 28 0.084 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 28 0.084 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 28 0.084 AF265299-1|AAG17642.1| 63|Tribolium castaneum putative cytochr... 22 5.5 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 27.9 bits (59), Expect = 0.084 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = +1 Query: 538 YSYLNFSKTRQRYEIRRTFVSEKARRTERVYLPPKTHLFRCYECNWES 681 Y YL S RY++ + R Y+PP + R + CNW S Sbjct: 170 YQYLR-STLSDRYKVFVDLFNLSTFLIPRSYIPPLSTSMRSHLCNWGS 216 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 27.9 bits (59), Expect = 0.084 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = +1 Query: 538 YSYLNFSKTRQRYEIRRTFVSEKARRTERVYLPPKTHLFRCYECNWES 681 Y YL S RY++ + R Y+PP + R + CNW S Sbjct: 330 YQYLR-STLSDRYKVFVDLFNLSTFLIPRSYIPPLSTSMRSHLCNWGS 376 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 27.9 bits (59), Expect = 0.084 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = +1 Query: 538 YSYLNFSKTRQRYEIRRTFVSEKARRTERVYLPPKTHLFRCYECNWES 681 Y YL S RY++ + R Y+PP + R + CNW S Sbjct: 330 YQYLR-STLSDRYKVFVDLFNLSTFLIPRSYIPPLSTSMRSHLCNWGS 376 >AF265299-1|AAG17642.1| 63|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 63 Score = 21.8 bits (44), Expect = 5.5 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -3 Query: 320 ASKISFALYC 291 AS ISFALYC Sbjct: 2 ASGISFALYC 11 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,496 Number of Sequences: 336 Number of extensions: 2470 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -