BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0679 (700 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0438 - 17737040-17737122,17737373-17737496,17737897-177381... 29 3.5 04_04_1434 - 33568258-33569415 29 3.5 07_03_0375 + 17408815-17409035,17422820-17423477,17423780-174241... 28 8.2 >11_04_0438 - 17737040-17737122,17737373-17737496,17737897-17738182, 17738265-17738397,17738742-17738953,17739455-17739816, 17739907-17739937,17744738-17745111 Length = 534 Score = 29.1 bits (62), Expect = 3.5 Identities = 15/63 (23%), Positives = 32/63 (50%) Frame = -2 Query: 402 RIKFQNRARNVQNDVND*TNKVHSSV*LFHSEIRNELTERTCRRMSYAYVSHGVTATAAF 223 +I+ QNR+RN+ + + V + L + E + E CRR+ +A+ + A+ + Sbjct: 135 KIEIQNRSRNLTVYASKVVDSVAYNAMLSYPEGQQEKCVAVCRRLEHAHALFDILASCSH 194 Query: 222 RSV 214 ++ Sbjct: 195 SNI 197 >04_04_1434 - 33568258-33569415 Length = 385 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +2 Query: 536 DMDFYIFNDIIY**TTRVVYYINTIIIPKHDHAVR 640 +M FY FN I+Y R +Y +NTI + + A++ Sbjct: 132 EMPFYWFNFIVYDDADRRMYCVNTIFVVRLARAIQ 166 >07_03_0375 + 17408815-17409035,17422820-17423477,17423780-17424161, 17424236-17424550,17424727-17425118,17432479-17432508 Length = 665 Score = 27.9 bits (59), Expect = 8.2 Identities = 11/44 (25%), Positives = 26/44 (59%) Frame = +1 Query: 361 VILYVPCAILKFYSLKRIIIFHMVFLFKHYMF*RERFMRNLGGP 492 +++++ C ++K S+ + H +F F+ YM ++++RN P Sbjct: 585 IMMHLLCHLVKEISILGPVYLHNMFPFERYMGVLKKYVRNRARP 628 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,867,787 Number of Sequences: 37544 Number of extensions: 214036 Number of successful extensions: 367 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 365 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 367 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -