BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0674 (700 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18582| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.68 SB_8363| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_52186| Best HMM Match : IMPDH (HMM E-Value=0) 28 8.4 SB_51224| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 >SB_18582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 499 Score = 31.5 bits (68), Expect = 0.68 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +3 Query: 288 EDKLKVEKLIDACLANKGNSPHQTAWNYVKCYHEKDPK-HALFL 416 E+ + V KL D L NKG PH N ++E DPK H LF+ Sbjct: 341 EESVDVTKL-DYYLMNKGYIPHADRLNDTLHHYETDPKYHRLFI 383 >SB_8363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 776 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -2 Query: 192 SMVRFQS*SRLSSVCSPIVHQLSSRRDSRLCVSSSSPSAH 73 S + +S S SSVC ++H+LS+ R +C S A+ Sbjct: 430 SYIVCRSISYTSSVCRSVIHRLSANRSKTVCRSIGHTGAY 469 >SB_52186| Best HMM Match : IMPDH (HMM E-Value=0) Length = 876 Score = 27.9 bits (59), Expect = 8.4 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 6/49 (12%) Frame = +3 Query: 228 LMTKDGKFKKDVALAKVPNAEDKLKVEKLIDACL------ANKGNSPHQ 356 L +KD K + V A AEDKL+VE LI A + +++GNS +Q Sbjct: 428 LASKDSKKQLLVGAAIGTRAEDKLRVEALIHAGVDVIILDSSQGNSAYQ 476 >SB_51224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 808 Score = 27.9 bits (59), Expect = 8.4 Identities = 19/61 (31%), Positives = 33/61 (54%) Frame = -3 Query: 407 SVLRVFLVVAFHIIPGCLVRAVAFVGQASVNQLLYFQFVFSIRHFSQSDVLLEFPVLGHQ 228 SVL VF+V+ +IPG V A +V N + +++VF+ Q ++L F +L + Sbjct: 26 SVLLVFMVLLIVMIPGTWVAAAIYVKHFQDN--VIWEYVFAGSCALQGILVLLFGLLDRE 83 Query: 227 L 225 + Sbjct: 84 I 84 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,748,313 Number of Sequences: 59808 Number of extensions: 344071 Number of successful extensions: 925 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 874 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 922 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -