BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0674 (700 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g19230.2 68417.m02837 cytochrome P450 family protein cytochro... 31 0.56 At5g17930.1 68418.m02102 MA3 domain-containing protein low simil... 31 0.73 At4g08310.1 68417.m01372 expressed protein glutamic acid-rich pr... 31 0.97 At5g17240.1 68418.m02020 SET domain-containing protein contains ... 30 1.7 At5g54730.1 68418.m06815 expressed protein 29 3.9 At4g02710.1 68417.m00366 kinase interacting family protein simil... 29 3.9 At1g66130.1 68414.m07505 oxidoreductase N-terminal domain-contai... 28 5.2 At2g26780.1 68415.m03212 expressed protein contains Pfam profile... 27 9.0 At2g04230.1 68415.m00410 F-box family protein contains F-box dom... 27 9.0 >At4g19230.2 68417.m02837 cytochrome P450 family protein cytochrome P450, Arabidopsis thaliana; supported by cDNA: gi_15293092_gb_AY050980.1_ Length = 484 Score = 31.5 bits (68), Expect = 0.56 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = -2 Query: 408 ERASGLSRGSISHNSRLFGEGCCLCWPGKRQS 313 ERA+G S G +SR C LCWPG R+S Sbjct: 439 ERATGFSMG----HSRFPKTDCPLCWPGSRRS 466 >At5g17930.1 68418.m02102 MA3 domain-containing protein low similarity to SP|Q9P6R9 Cell cycle control protein cwf22 {Schizosaccharomyces pombe}; contains Pfam profile PF02847: MA3 domain Length = 707 Score = 31.1 bits (67), Expect = 0.73 Identities = 25/104 (24%), Positives = 47/104 (45%), Gaps = 2/104 (1%) Frame = +3 Query: 105 ADCLSETKADE--QLVNKLKTGDFKTENEPLKKXALCMLIKSQLMTKDGKFKKDVALAKV 278 A+ ++ET E + LK + + N +K C+++ S+ F+K + L + Sbjct: 479 AEDIAETMDAEVVEAQKMLKLAEAQRMNTDSRKAIFCVIMSSEDYID--AFEKLLRL-DL 535 Query: 279 PNAEDKLKVEKLIDACLANKGNSPHQTAWNYVKCYHEKDPKHAL 410 P +D+ + L++ CL K + T C H+K+ K L Sbjct: 536 PGKQDREIMRVLVECCLQEKAFNKFYTVLASKLCEHDKNHKFTL 579 >At4g08310.1 68417.m01372 expressed protein glutamic acid-rich protein precursor - Plasmodium falciparum, PIR2:A54514 Length = 504 Score = 30.7 bits (66), Expect = 0.97 Identities = 20/56 (35%), Positives = 29/56 (51%) Frame = +3 Query: 81 KENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKXALCMLIKSQLMTKDGK 248 K +K+H CL+ + DE N L+T + K + P+K+ A L K KDGK Sbjct: 80 KSFVKQHLVQCLAGAENDETSENSLET-EKKDDVTPVKEAA--ELSKEHTTKKDGK 132 >At5g17240.1 68418.m02020 SET domain-containing protein contains Pfam profile PF00856: SET domain Length = 491 Score = 29.9 bits (64), Expect = 1.7 Identities = 17/67 (25%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Frame = +3 Query: 189 LKKXALCMLI-KSQLMTKDGKFKKDVALAKVPNAEDKLKVEKLIDACLANKGNSPHQTAW 365 LKK L + + + LMT + KD+ L+ N + L +++ CL + + ++ W Sbjct: 57 LKKGELVLKVPRKALMTTESIIAKDLKLSDAVNLHNSLSSTQILSVCLLYEMSKEKKSFW 116 Query: 366 NYVKCYH 386 Y +H Sbjct: 117 -YPYLFH 122 >At5g54730.1 68418.m06815 expressed protein Length = 763 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +1 Query: 559 FDKXXLXVVTYSIENQNLXFFCVRHSFGXSRLMVLGDFFHLIQ 687 FD+ L +VT SI+ N+ F + + SR + F HL + Sbjct: 355 FDQSGLLLVTASIQGHNINVFRIMPTISTSRAVKTTTFAHLFR 397 >At4g02710.1 68417.m00366 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 1111 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -2 Query: 429 DYVFTRKERASGLSRGSISHNSRLFGEGCCL 337 DYVFT +E A +S+G+ + L EG CL Sbjct: 781 DYVFTHRESAGEVSKGADLMDEFLKLEGMCL 811 >At1g66130.1 68414.m07505 oxidoreductase N-terminal domain-containing protein similar to AX110P [Daucus carota] GI:285739; contains Pfam profile PF01408: Oxidoreductase family NAD-binding Rossmann fold Length = 364 Score = 28.3 bits (60), Expect = 5.2 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +3 Query: 252 KKDVALAKVPNAEDKLKVEKLIDACLANKGNSPHQTAW 365 KK L + P A+D ++EK+++AC N T W Sbjct: 95 KKKHVLVEKPPAQDATELEKIVEACEYNGVQFMDGTIW 132 >At2g26780.1 68415.m03212 expressed protein contains Pfam profile TBP (TATA-binding protein) -interacting protein 120 (TIP120); contains TIGRFAM profile TIGR01612: reticulocyte binding protein Length = 1866 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = +2 Query: 320 RLPGQQRQQPSPNSLELCEMLPRERPE 400 R P ++R++ +PN+LE LP++ E Sbjct: 114 RAPAKEREEIAPNTLENVSKLPKQHQE 140 >At2g04230.1 68415.m00410 F-box family protein contains F-box domain Pfam:PF00646 Length = 448 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +3 Query: 282 NAEDKLKVEKLIDACLANKGNSPHQTAWNYVKCYHE 389 ++ KL++ KL D L + +P + WN KC E Sbjct: 333 DSSPKLQILKLTDVYLHDNKTNPDERKWNPPKCAPE 368 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,226,739 Number of Sequences: 28952 Number of extensions: 246708 Number of successful extensions: 548 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 541 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 548 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -