BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0673 (600 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U29096-4|AAA68408.1| 1599|Caenorhabditis elegans Hypothetical pr... 29 3.3 Z81503-1|CAB04111.1| 305|Caenorhabditis elegans Hypothetical pr... 28 5.9 >U29096-4|AAA68408.1| 1599|Caenorhabditis elegans Hypothetical protein F30H5.3 protein. Length = 1599 Score = 28.7 bits (61), Expect = 3.3 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +1 Query: 76 GGPLTRVRNGPRGNPSAWACNCSLMNCGFVCCSRLAVGG 192 G P+ +G P+ + C S ++ F CCS ++ GG Sbjct: 1479 GTPVQCSNSGSNSCPAGYKCQKSTLSNRFQCCSSVSGGG 1517 >Z81503-1|CAB04111.1| 305|Caenorhabditis elegans Hypothetical protein F14F7.1 protein. Length = 305 Score = 27.9 bits (59), Expect = 5.9 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 45 PARNSIGNGGGRPPYEGAERAPGKP 119 PA + +GGGRP G + APG+P Sbjct: 234 PAGHPGSSGGGRPGPAGPKGAPGQP 258 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,363,251 Number of Sequences: 27780 Number of extensions: 210874 Number of successful extensions: 721 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 684 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 720 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1279376318 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -