Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brP-0665
         (662 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ325089-1|ABD14103.1|  185|Apis mellifera complementary sex det...    22   4.5  
DQ325088-1|ABD14102.1|  185|Apis mellifera complementary sex det...    22   4.5  
DQ325087-1|ABD14101.1|  179|Apis mellifera complementary sex det...    22   4.5  
DQ325086-1|ABD14100.1|  179|Apis mellifera complementary sex det...    22   4.5  
DQ325085-1|ABD14099.1|  179|Apis mellifera complementary sex det...    22   4.5  
DQ325084-1|ABD14098.1|  179|Apis mellifera complementary sex det...    22   4.5  
S76959-1|AAB33934.1|   85|Apis mellifera olfactory receptor prot...    21   7.9  
AB207270-1|BAE72137.1|  429|Apis mellifera broad-complex protein.      21   7.9  

>DQ325089-1|ABD14103.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +2

Query: 194 HENKYKYIFNKN 229
           H N YKY +N N
Sbjct: 90  HNNNYKYNYNNN 101


>DQ325088-1|ABD14102.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +2

Query: 194 HENKYKYIFNKN 229
           H N YKY +N N
Sbjct: 90  HNNNYKYNYNNN 101


>DQ325087-1|ABD14101.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +2

Query: 194 HENKYKYIFNKN 229
           H N YKY +N N
Sbjct: 91  HNNNYKYNYNNN 102


>DQ325086-1|ABD14100.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +2

Query: 194 HENKYKYIFNKN 229
           H N YKY +N N
Sbjct: 91  HNNNYKYNYNNN 102


>DQ325085-1|ABD14099.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +2

Query: 194 HENKYKYIFNKN 229
           H N YKY +N N
Sbjct: 91  HNNNYKYNYNNN 102


>DQ325084-1|ABD14098.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +2

Query: 194 HENKYKYIFNKN 229
           H N YKY +N N
Sbjct: 91  HNNNYKYNYNNN 102


>S76959-1|AAB33934.1|   85|Apis mellifera olfactory receptor
           protein.
          Length = 85

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 7/24 (29%), Positives = 17/24 (70%)
 Frame = -3

Query: 312 LMVDSSVYVIIFYSLNIYNVFESS 241
           +++ SS+ ++I Y+L ++N+   S
Sbjct: 18  VVIVSSLIILISYALILFNILHMS 41


>AB207270-1|BAE72137.1|  429|Apis mellifera broad-complex protein.
          Length = 429

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 11/38 (28%), Positives = 19/38 (50%)
 Frame = +1

Query: 334 LVNIIFSKNHSLTRVTYII*IKKHSRLMSNKLTVTKLL 447
           L ++ FS  H+L    Y   +  H R +S+ L   ++L
Sbjct: 73  LQDVAFSDLHALVEFIYHGEVNVHQRSLSSFLKTAEVL 110


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 163,434
Number of Sequences: 438
Number of extensions: 3314
Number of successful extensions: 9
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 19977660
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)