BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0664 (300 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g12450.1 68417.m01970 expressed protein 30 0.25 At1g27060.1 68414.m03299 regulator of chromosome condensation (R... 29 0.58 At3g61940.1 68416.m06956 zinc transporter, putative similar to z... 27 2.3 At2g07630.1 68415.m00881 hypothetical protein 27 2.3 At5g53440.1 68418.m06641 expressed protein 27 3.1 At2g12100.1 68415.m01300 Ulp1 protease family protein contains P... 27 3.1 At2g03150.1 68415.m00268 ATP/GTP-binding protein family contains... 27 3.1 At1g45090.1 68414.m05169 Ulp1 protease family protein similar to... 27 3.1 At5g45350.1 68418.m05567 proline-rich family protein contains pr... 26 4.1 At4g09060.1 68417.m01493 expressed protein 26 4.1 At5g35750.1 68418.m04281 histidine kinase (AHK2) identical to hi... 26 5.4 At4g18160.1 68417.m02698 outward rectifying potassium channel, p... 26 5.4 At4g11610.1 68417.m01859 C2 domain-containing protein contains I... 26 5.4 At2g46610.2 68415.m05813 arginine/serine-rich splicing factor, p... 26 5.4 At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, p... 26 5.4 At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family... 26 5.4 At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC... 25 7.1 At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC... 25 7.1 At4g35480.1 68417.m05042 zinc finger (C3HC4-type RING finger) fa... 25 7.1 At4g21070.1 68417.m03047 BRCT domain-containing protein / zinc f... 25 7.1 At4g15545.1 68417.m02375 expressed protein 25 7.1 At1g21630.1 68414.m02708 calcium-binding EF hand family protein ... 25 7.1 At5g62760.2 68418.m07879 nuclear protein ZAP-related similar to ... 25 9.4 At5g62760.1 68418.m07878 nuclear protein ZAP-related similar to ... 25 9.4 At3g45060.1 68416.m04857 high-affinity nitrate transporter, puta... 25 9.4 At3g43590.1 68416.m04638 zinc knuckle (CCHC-type) family protein... 25 9.4 At3g13090.1 68416.m01639 ABC transporter, putative similar to MR... 25 9.4 At2g19270.1 68415.m02249 expressed protein 25 9.4 >At4g12450.1 68417.m01970 expressed protein Length = 277 Score = 30.3 bits (65), Expect = 0.25 Identities = 17/57 (29%), Positives = 27/57 (47%) Frame = -2 Query: 290 CRAVSRDIRTTTEARRPGTARNTRRPKPTELSVCCRERSETPRHRNKPSRPVWSRRS 120 CR RD+ T +PGT + +P P+ +C R E + + P+R S R+ Sbjct: 36 CRKNVRDVVNT----QPGTVKKNPKPDPSLRRLCSSRRPELDSNSHHPTRRSVSARA 88 >At1g27060.1 68414.m03299 regulator of chromosome condensation (RCC1) family protein low similiarity to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 386 Score = 29.1 bits (62), Expect = 0.58 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +3 Query: 237 AWAPGLCGGPDVPAHGSAP 293 +W G CGGPDV A S P Sbjct: 229 SWGRGFCGGPDVHAPQSLP 247 >At3g61940.1 68416.m06956 zinc transporter, putative similar to zinc transporter ZAT [Arabidopsis thaliana] gi|4206640|gb|AAD11757; similar to zinc transporter ZnT-2 [Rattus norvegicus] gi|1256378|gb|AAB02775; member of the cation diffusion facilitator (CDF) family, or cation efflux (CE) family, PMID:11500563 Length = 334 Score = 27.1 bits (57), Expect = 2.3 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -1 Query: 273 GHQDHHRGPAPRHSEKHSASEADRAERLL 187 GH DH G HS H S +RAE+LL Sbjct: 157 GH-DHGHGHDHGHSHDHGHSYGERAEQLL 184 >At2g07630.1 68415.m00881 hypothetical protein Length = 458 Score = 27.1 bits (57), Expect = 2.3 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +2 Query: 65 QQLNCSSSISKYYNGNGVDSVETKQVEKVYSGDGASLSAPGSKRSA-LSASDAECFS 232 Q L C + +K Y + DS++ + YS + + + P SKRS+ S S A+ FS Sbjct: 369 QYLVCVENENKRYQMH--DSIDQCSLMLTYSEEPSEATTPSSKRSSDTSISPADNFS 423 >At5g53440.1 68418.m06641 expressed protein Length = 1181 Score = 26.6 bits (56), Expect = 3.1 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = -1 Query: 297 RAVQSREQGHQDHHRGPAPRHSEKHSASEADRAE 196 R+++ E GH+++ R + E+H E +AE Sbjct: 550 RSIEVEETGHRNNARDYSATEEERHLVDETSQAE 583 >At2g12100.1 68415.m01300 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At5g28270, At2g05450, At1g45090, At2g16180, At2g06750 Length = 1224 Score = 26.6 bits (56), Expect = 3.1 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -1 Query: 255 RGPAPRHSEKHSASEADRAERLLPGALRDAPSPE 154 R P+P H +H + E+LLP + P+ E Sbjct: 681 RVPSPSHQPEHGIPDGGNFEQLLPDPILSDPALE 714 >At2g03150.1 68415.m00268 ATP/GTP-binding protein family contains ATP/GTP-binding site motif A (P-loop), PROSITE:PS00017 Length = 1340 Score = 26.6 bits (56), Expect = 3.1 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = -2 Query: 254 EARRPGTARNTRRPKPTELSVCCRERSETPRHRNKPSRPVWSRRSPHHFHCSI 96 E +R + R P S +ER+ P+ ++ +R RR HH SI Sbjct: 418 ERKRALEIKRDRTPTARATSKDTKERTPVPKSISRDARSSSLRRDAHHREASI 470 >At1g45090.1 68414.m05169 Ulp1 protease family protein similar to At5g28270, At2g12100, At2g05450, At2g16180, At2g06750; contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 1210 Score = 26.6 bits (56), Expect = 3.1 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -1 Query: 255 RGPAPRHSEKHSASEADRAERLLPGALRDAPSPE 154 R P+P H +H + E+LLP + P+ E Sbjct: 672 RVPSPSHQPEHGIPDGGNFEQLLPDPILSDPALE 705 >At5g45350.1 68418.m05567 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 177 Score = 26.2 bits (55), Expect = 4.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 243 APGLCGGPDVPAHGSAPP 296 APG G P P HG PP Sbjct: 73 APGYGGYPPAPGHGGYPP 90 >At4g09060.1 68417.m01493 expressed protein Length = 341 Score = 26.2 bits (55), Expect = 4.1 Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -2 Query: 248 RRPGTARNTRRPKPTELSVCCRERSE--TPRHRNKPSRPVWS 129 R +A++ +R P +S +R E +P KP PVW+ Sbjct: 290 RNSASAKSNKRKSPKTMSSPVEKRLEFSSPEISRKPLSPVWN 331 >At5g35750.1 68418.m04281 histidine kinase (AHK2) identical to histidine kinase AHK2 [Arabidopsis thaliana] gi|13537196|dbj|BAB40774 Length = 1176 Score = 25.8 bits (54), Expect = 5.4 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +2 Query: 71 LNCSSSISKYYNGNGVDSVETKQVEKVYSGDGASLSAPG 187 + SS S+ Y G G+ +K++ ++ G+ +S PG Sbjct: 816 MQADSSTSRTYGGTGIGLSISKRLVELMQGEMGFVSEPG 854 >At4g18160.1 68417.m02698 outward rectifying potassium channel, putative (KCO6) similar to kco1 [Arabidopsis thaliana] gi|2230761|emb|CAA69158; member of the 2 pore, 4 transmembrane (2P/4TM) K+ channel family, PMID:11500563 Length = 436 Score = 25.8 bits (54), Expect = 5.4 Identities = 12/30 (40%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Frame = +1 Query: 193 TLSSVGFGRRVFLAVPGRR-ASVVVLMSLL 279 ++++VG+G R F +PGR A++ +L+S L Sbjct: 310 SVTTVGYGDRAFKTLPGRLFAAIWLLVSTL 339 >At4g11610.1 68417.m01859 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1011 Score = 25.8 bits (54), Expect = 5.4 Identities = 9/36 (25%), Positives = 17/36 (47%) Frame = -1 Query: 294 AVQSREQGHQDHHRGPAPRHSEKHSASEADRAERLL 187 ++ + + H +HH P+H SE R +L+ Sbjct: 193 SLAAEQDNHNEHHHHYVPKHQVDEMRSEPARPSKLV 228 >At2g46610.2 68415.m05813 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 224 Score = 25.8 bits (54), Expect = 5.4 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 185 RERSETPRHRNKPSRPVWSRRSPHH 111 R RS +P +R +PS RRSP + Sbjct: 154 RRRSPSPVYRRRPSPDYTRRRSPEY 178 >At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 250 Score = 25.8 bits (54), Expect = 5.4 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 185 RERSETPRHRNKPSRPVWSRRSPHH 111 R RS +P +R +PS RRSP + Sbjct: 180 RRRSPSPVYRRRPSPDYTRRRSPEY 204 >At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1696 Score = 25.8 bits (54), Expect = 5.4 Identities = 14/46 (30%), Positives = 17/46 (36%) Frame = -2 Query: 248 RRPGTARNTRRPKPTELSVCCRERSETPRHRNKPSRPVWSRRSPHH 111 RR + R P+ R ETPR WSR+ HH Sbjct: 300 RREASNELNRTPRKQVQKKSALLRLETPRSYKNSRENEWSRQHNHH 345 >At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 25.4 bits (53), Expect = 7.1 Identities = 17/59 (28%), Positives = 26/59 (44%), Gaps = 2/59 (3%) Frame = -2 Query: 287 RAVSRDIRTTTEARRPGTARNTRRPKPTELSVCCR--ERSETPRHRNKPSRPVWSRRSP 117 R+ SR + + R P ++ + E+S R ERS +PR P P + SP Sbjct: 206 RSHSRSLSASPARRSPRSSSPQKTSPAREVSPDKRSNERSPSPRRSLSPRSPALQKASP 264 >At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 25.4 bits (53), Expect = 7.1 Identities = 17/59 (28%), Positives = 26/59 (44%), Gaps = 2/59 (3%) Frame = -2 Query: 287 RAVSRDIRTTTEARRPGTARNTRRPKPTELSVCCR--ERSETPRHRNKPSRPVWSRRSP 117 R+ SR + + R P ++ + E+S R ERS +PR P P + SP Sbjct: 206 RSHSRSLSASPARRSPRSSSPQKTSPAREVSPDKRSNERSPSPRRSLSPRSPALQKASP 264 >At4g35480.1 68417.m05042 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain PF00097: Zinc finger, C3HC4 type (RING finger) Length = 200 Score = 25.4 bits (53), Expect = 7.1 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +3 Query: 195 AQLCRLRTPSVSRCAWAPGLCGGPDVPAHGSAPP 296 A +C +V+RCAW L G + A G APP Sbjct: 36 ALVCVAGLAAVARCAWLRRLT-GVNPAAVGEAPP 68 >At4g21070.1 68417.m03047 BRCT domain-containing protein / zinc finger (C3HC4-type RING finger) family protein (BRCA1) contains Pfam profiles PF00533: BRCA1 C Terminus (BRCT) domain, PF00097: Zinc finger, C3HC4 type (RING finger), PF01535: PPR repeat; identical to cDNA BRCA1 GI:28372473 Length = 1276 Score = 25.4 bits (53), Expect = 7.1 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -1 Query: 276 QGHQDHHRGPAPRHSEKHSASE 211 +G QD GP+ H EK S +E Sbjct: 764 KGDQDQAHGPSDTHPEKRSPTE 785 >At4g15545.1 68417.m02375 expressed protein Length = 337 Score = 25.4 bits (53), Expect = 7.1 Identities = 15/43 (34%), Positives = 19/43 (44%) Frame = -1 Query: 240 RHSEKHSASEADRAERLLPGALRDAPSPE*TFSTCLVSTESTP 112 RHS S ++ E DAP P + S LVS +TP Sbjct: 168 RHSSIQSQQASEAIEPAATDNENDAPKPSLSASLPLVSQTTTP 210 >At1g21630.1 68414.m02708 calcium-binding EF hand family protein contains INTERPRO:IPR002048 calcium-binding EF-hand domain; ESTs gb|T44428 and gb|AA395440 come from this gene Length = 1218 Score = 25.4 bits (53), Expect = 7.1 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -3 Query: 298 PGGAEP*AGTSGPPQRP 248 PGG P AG G P RP Sbjct: 540 PGGLRPPAGPKGKPPRP 556 >At5g62760.2 68418.m07879 nuclear protein ZAP-related similar to nuclear protein ZAP, Mus musculus, EMBL:AB033168 this cDNA provides a truncated ORF likely due to a skipped exon. An alternative ORF is provided. Length = 383 Score = 25.0 bits (52), Expect = 9.4 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +2 Query: 110 NGVDSVETKQVEKVYSGDGASLSAPGSKRSALSASDAECF 229 + +D +VEKV D SLS+ SKR + C+ Sbjct: 311 HSMDDYFMTEVEKVEESDSTSLSSGRSKRPIVKTVMEYCY 350 >At5g62760.1 68418.m07878 nuclear protein ZAP-related similar to nuclear protein ZAP, Mus musculus, EMBL:AB033168 this cDNA provides a truncated ORF likely due to a skipped exon. An alternative ORF is provided. Length = 661 Score = 25.0 bits (52), Expect = 9.4 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +2 Query: 110 NGVDSVETKQVEKVYSGDGASLSAPGSKRSALSASDAECF 229 + +D +VEKV D SLS+ SKR + C+ Sbjct: 311 HSMDDYFMTEVEKVEESDSTSLSSGRSKRPIVKTVMEYCY 350 >At3g45060.1 68416.m04857 high-affinity nitrate transporter, putative similar to trans-membrane nitrate transporter protein AtNRT2:1 [Arabidopsis thaliana] GI:3747058, high-affinity nitrate transporter ACH1 [Arabidopsis thaliana] GI:3608362 Length = 542 Score = 25.0 bits (52), Expect = 9.4 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 8/57 (14%) Frame = -1 Query: 300 LRAVQSREQGHQDHHRGPAPRHSEK----HSAS----EADRAERLLPGALRDAPSPE 154 LR Q E+ ++H+ G EK H S E R+ER L D P+PE Sbjct: 479 LRPSQDGEKSKEEHYYGAEWTEEEKSLGLHEGSIKFAENSRSERGRKAMLADIPTPE 535 >At3g43590.1 68416.m04638 zinc knuckle (CCHC-type) family protein contains Pfam domain, PF00098: Zinc knuckle Length = 551 Score = 25.0 bits (52), Expect = 9.4 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -2 Query: 176 SETPRHRNKPSRPVWSRRSPHHFH 105 S++ RH + PS W HH H Sbjct: 492 SQSSRHHSGPSPSRWQPSHQHHHH 515 >At3g13090.1 68416.m01639 ABC transporter, putative similar to MRP-like ABC transporter [Arabidopsis thaliana] GI:2316016; contains Pfam profile: PF00005 ABC transporter Length = 1466 Score = 25.0 bits (52), Expect = 9.4 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = +2 Query: 77 CSSSISKYYNGNGVDSVETKQVEKVYSGDGASLSAPGSKRSALS 208 C S + K G +D ++ + S D ++AP SK LS Sbjct: 173 CCSCLWKKGEGERIDLLKEPLLSSAESSDNEEVTAPFSKAGILS 216 >At2g19270.1 68415.m02249 expressed protein Length = 359 Score = 25.0 bits (52), Expect = 9.4 Identities = 19/45 (42%), Positives = 21/45 (46%) Frame = +2 Query: 119 DSVETKQVEKVYSGDGASLSAPGSKRSALSASDAECFSLCLGAGP 253 D E K +K + AS S S RS LSA A S LGA P Sbjct: 111 DEEEEKARKKRKQMESASASHDSSVRSFLSAMPAPKSSQTLGALP 155 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,982,885 Number of Sequences: 28952 Number of extensions: 132154 Number of successful extensions: 502 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 488 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 502 length of database: 12,070,560 effective HSP length: 70 effective length of database: 10,043,920 effective search space used: 291273680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -