BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0662 (700 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory recept... 25 0.79 AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory recept... 25 0.79 AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory recept... 25 0.79 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 25 0.79 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 24 1.4 AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory recept... 21 7.3 >AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory receptor candidate 30 protein. Length = 394 Score = 24.6 bits (51), Expect = 0.79 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 659 VSAEHSTIFDSXKLFCQFLSLFQ*NRLLFYFS 564 + A T+ K+F + L++ + NRL FY S Sbjct: 80 LGATFVTVLQLHKIFAKGLNVIEANRLFFYCS 111 >AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory receptor candidate 29 protein. Length = 429 Score = 24.6 bits (51), Expect = 0.79 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 659 VSAEHSTIFDSXKLFCQFLSLFQ*NRLLFYFS 564 + A T+ K+F + L++ + NRL FY S Sbjct: 80 LGATFVTVLQLHKIFAKGLNVIEANRLFFYCS 111 >AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory receptor candidate 7 protein. Length = 429 Score = 24.6 bits (51), Expect = 0.79 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 659 VSAEHSTIFDSXKLFCQFLSLFQ*NRLLFYFS 564 + A T+ K+F + L++ + NRL FY S Sbjct: 80 LGATFVTVLQLHKIFAKGLNVIEANRLFFYCS 111 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 24.6 bits (51), Expect = 0.79 Identities = 9/40 (22%), Positives = 19/40 (47%) Frame = +3 Query: 480 THHQQKTPFLLVGTQIDLRDDSATMEKLAKIKQKPVSLEQ 599 THH K P +GT + + +E++ + +++ Q Sbjct: 276 THHLDKNPENTLGTMLSIHPSKLDVEQMNLLHSNDLNMHQ 315 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 23.8 bits (49), Expect = 1.4 Identities = 11/20 (55%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Frame = +1 Query: 106 EPNSPYNKRKFGV-QIVKKQ 162 EP SP+ +FGV QIVK++ Sbjct: 27 EPRSPHTAWQFGVSQIVKRE 46 >AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory receptor candidate 22 protein. Length = 301 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 462 KWVPEITHHQQKTPFLLVGTQIDL 533 K ++ + KT LLVG +ID+ Sbjct: 211 KRASDLCNEANKTKILLVGLKIDI 234 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,918 Number of Sequences: 336 Number of extensions: 3635 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -