BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0661 (351 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0674 - 5502275-5502954,5503054-5504746 27 4.1 10_08_1024 + 22371260-22371481,22371514-22372188,22372291-223732... 27 4.1 07_01_0173 - 1212858-1213805,1214982-1215642,1215699-1215724,121... 27 4.1 10_03_0002 - 6858257-6861205 27 5.5 11_04_0341 - 16565757-16566418,16566668-16567799,16567965-16568549 26 7.2 10_01_0127 - 1519803-1520036,1520802-1521095,1521840-1522614,152... 26 7.2 07_03_1436 - 26543846-26546806 26 7.2 06_03_0390 - 20280355-20281178,20281392-20281565,20281613-20281847 26 7.2 >11_01_0674 - 5502275-5502954,5503054-5504746 Length = 790 Score = 27.1 bits (57), Expect = 4.1 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 3/33 (9%) Frame = +2 Query: 188 PFYFCCTECIKFGCCH-ERQTF-NC-DGFSNRS 277 PF FC C FG C R+ F +C +GFS +S Sbjct: 324 PFSFCIATCGPFGVCDGSRKPFCDCMEGFSPKS 356 >10_08_1024 + 22371260-22371481,22371514-22372188,22372291-22373236, 22389377-22389552 Length = 672 Score = 27.1 bits (57), Expect = 4.1 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 113 NMCNRNKMADQNSIPTNADSTRTP 184 N+ N+ K S+P N+ STRTP Sbjct: 136 NILNQTKTMIATSVPANSASTRTP 159 >07_01_0173 - 1212858-1213805,1214982-1215642,1215699-1215724, 1216037-1216121,1216382-1216404,1216463-1216465 Length = 581 Score = 27.1 bits (57), Expect = 4.1 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 131 KMADQNSIPTNADSTRTPVPFYFCCTECIK 220 K+ +N+I TN S V FY C C++ Sbjct: 355 KLLKENNIWTNGSSDSCVVTFYSSCRNCLE 384 >10_03_0002 - 6858257-6861205 Length = 982 Score = 26.6 bits (56), Expect = 5.5 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +2 Query: 104 YLHNMCNRNKMADQNSIPTNADSTRTP 184 ++ N+ N+ K S+P N++S RTP Sbjct: 306 HVDNILNQTKTMIAASVPVNSESVRTP 332 >11_04_0341 - 16565757-16566418,16566668-16567799,16567965-16568549 Length = 792 Score = 26.2 bits (55), Expect = 7.2 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 113 NMCNRNKMADQNSIPTNADSTRTP 184 N+ N+ K S+P N+ STRTP Sbjct: 257 NILNQTKTMIAASVPVNSASTRTP 280 >10_01_0127 - 1519803-1520036,1520802-1521095,1521840-1522614, 1524574-1525412 Length = 713 Score = 26.2 bits (55), Expect = 7.2 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 115 YVQQKQNGGSKFDTYQR*FN 174 +VQQ QNGGS F+ + FN Sbjct: 462 FVQQTQNGGSLFEQGENYFN 481 >07_03_1436 - 26543846-26546806 Length = 986 Score = 26.2 bits (55), Expect = 7.2 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 113 NMCNRNKMADQNSIPTNADSTRTP 184 N+ N+ K S+P N+ STRTP Sbjct: 312 NILNQTKTMIAASVPANSASTRTP 335 >06_03_0390 - 20280355-20281178,20281392-20281565,20281613-20281847 Length = 410 Score = 26.2 bits (55), Expect = 7.2 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 113 NMCNRNKMADQNSIPTNADSTRTP 184 N+ N+ K S+P N+ STRTP Sbjct: 112 NILNQTKTMIAASVPANSASTRTP 135 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,093,082 Number of Sequences: 37544 Number of extensions: 145866 Number of successful extensions: 278 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 274 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 278 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 518263348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -