BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0661 (351 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ252203-1|CAB64656.1| 219|Drosophila melanogaster putative COQ... 29 2.2 AJ252202-1|CAB64655.1| 219|Drosophila melanogaster putative COQ... 29 2.2 AE014298-949|AAF46199.2| 219|Drosophila melanogaster CG14437-PA... 29 2.2 AE014297-1896|AAF55096.2| 1010|Drosophila melanogaster CG7362-PA... 28 2.9 BT028783-1|ABI34164.1| 178|Drosophila melanogaster IP07257p pro... 27 5.1 AY095177-1|AAM12270.1| 487|Drosophila melanogaster GH12942p pro... 27 5.1 AE013599-2337|AAF57958.1| 178|Drosophila melanogaster CG5267-PA... 27 5.1 AE013599-2061|AAF58135.2| 765|Drosophila melanogaster CG8179-PA... 27 5.1 >AJ252203-1|CAB64656.1| 219|Drosophila melanogaster putative COQ7 isologue protein. Length = 219 Score = 28.7 bits (61), Expect = 2.2 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 140 DQNSIPTNADSTRTPVPFYFCCTECIKFGC 229 +Q T D PFY TE IKFGC Sbjct: 180 EQEHHDTGIDHGAEQAPFYQAMTEVIKFGC 209 >AJ252202-1|CAB64655.1| 219|Drosophila melanogaster putative COQ7 isologue protein. Length = 219 Score = 28.7 bits (61), Expect = 2.2 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 140 DQNSIPTNADSTRTPVPFYFCCTECIKFGC 229 +Q T D PFY TE IKFGC Sbjct: 180 EQEHHDTGIDHGAEQAPFYQAMTEVIKFGC 209 >AE014298-949|AAF46199.2| 219|Drosophila melanogaster CG14437-PA protein. Length = 219 Score = 28.7 bits (61), Expect = 2.2 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 140 DQNSIPTNADSTRTPVPFYFCCTECIKFGC 229 +Q T D PFY TE IKFGC Sbjct: 180 EQEHHDTGIDHGAEQAPFYQAMTEVIKFGC 209 >AE014297-1896|AAF55096.2| 1010|Drosophila melanogaster CG7362-PA protein. Length = 1010 Score = 28.3 bits (60), Expect = 2.9 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +3 Query: 102 FIYIICATETKWRIKIR-YLPTLIQRGHLC 188 +IY++C T+ + KIR Y L QR LC Sbjct: 97 YIYLVCITQIIFFFKIRKYAGNLCQRASLC 126 >BT028783-1|ABI34164.1| 178|Drosophila melanogaster IP07257p protein. Length = 178 Score = 27.5 bits (58), Expect = 5.1 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +2 Query: 176 RTPVPFYFCCTECIKFGCCHERQTFNCDG 262 R P+P + KFGCCH C G Sbjct: 92 RNPLPEEKYIKQPFKFGCCHNSTYVGCAG 120 >AY095177-1|AAM12270.1| 487|Drosophila melanogaster GH12942p protein. Length = 487 Score = 27.5 bits (58), Expect = 5.1 Identities = 14/42 (33%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +2 Query: 122 NRNKMADQNSIPTNADSTRTPV-PFYFCCTECIKFGCCHERQ 244 NRN A A RTP P CC + CCH ++ Sbjct: 330 NRNLSAADWLFEERAGRQRTPAAPTVICCCSAAEDCCCHRQR 371 >AE013599-2337|AAF57958.1| 178|Drosophila melanogaster CG5267-PA protein. Length = 178 Score = 27.5 bits (58), Expect = 5.1 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +2 Query: 176 RTPVPFYFCCTECIKFGCCHERQTFNCDG 262 R P+P + KFGCCH C G Sbjct: 92 RNPLPEEKYIKQPFKFGCCHNSTYVGCAG 120 >AE013599-2061|AAF58135.2| 765|Drosophila melanogaster CG8179-PA protein. Length = 765 Score = 27.5 bits (58), Expect = 5.1 Identities = 14/42 (33%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +2 Query: 122 NRNKMADQNSIPTNADSTRTPV-PFYFCCTECIKFGCCHERQ 244 NRN A A RTP P CC + CCH ++ Sbjct: 330 NRNLSAADWLFEERAGRQRTPAAPTVICCCSAAEDCCCHRQR 371 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,848,333 Number of Sequences: 53049 Number of extensions: 266928 Number of successful extensions: 972 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 955 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 972 length of database: 24,988,368 effective HSP length: 76 effective length of database: 20,956,644 effective search space used: 838265760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -