BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0658 (700 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M99438-1|AAA61194.1| 772|Homo sapiens transducin-like enhancer ... 71 3e-12 BC043247-1|AAH43247.1| 767|Homo sapiens TLE3 protein protein. 71 3e-12 AY583460-1|AAS90946.1| 767|Homo sapiens transducin-like enhance... 71 3e-12 AY583459-1|AAS90945.1| 764|Homo sapiens transducin-like enhance... 71 3e-12 AB046767-1|BAB13373.1| 863|Homo sapiens KIAA1547 protein protein. 71 3e-12 BC059405-1|AAH59405.2| 805|Homo sapiens TLE4 protein protein. 69 2e-11 BC045650-1|AAH45650.1| 704|Homo sapiens TLE4 protein protein. 69 2e-11 AL445252-3|CAI13644.1| 764|Homo sapiens transducin-like enhance... 69 2e-11 AL445252-2|CAI13643.1| 213|Homo sapiens transducin-like enhance... 69 2e-11 AL445252-1|CAI13642.1| 128|Homo sapiens transducin-like enhance... 69 2e-11 AL358975-5|CAC22599.1| 101|Homo sapiens transducin-like enhance... 69 2e-11 AL358975-4|CAC22598.1| 91|Homo sapiens transducin-like enhance... 69 2e-11 AL358975-3|CAI13734.1| 764|Homo sapiens transducin-like enhance... 69 2e-11 AL358975-2|CAI13733.1| 213|Homo sapiens transducin-like enhance... 69 2e-11 AL358975-1|CAI13732.1| 128|Homo sapiens transducin-like enhance... 69 2e-11 AL353813-5|CAI41315.1| 764|Homo sapiens transducin-like enhance... 69 2e-11 AL353813-4|CAI41314.1| 213|Homo sapiens transducin-like enhance... 69 2e-11 AL353813-3|CAI41313.1| 128|Homo sapiens transducin-like enhance... 69 2e-11 AB033087-1|BAA86575.1| 787|Homo sapiens KIAA1261 protein protein. 69 2e-11 BC041831-1|AAH41831.1| 772|Homo sapiens TLE3 protein protein. 63 8e-10 AL445252-5|CAI13646.1| 195|Homo sapiens transducin-like enhance... 62 2e-09 AL445252-4|CAI13645.1| 161|Homo sapiens transducin-like enhance... 62 2e-09 AL358975-7|CAI13736.1| 195|Homo sapiens transducin-like enhance... 62 2e-09 AL358975-6|CAI13735.1| 161|Homo sapiens transducin-like enhance... 62 2e-09 AL353813-6|CAI41316.1| 195|Homo sapiens transducin-like enhance... 62 2e-09 M99436-1|AAA61193.1| 743|Homo sapiens transducin-like enhancer ... 61 3e-09 BC017364-1|AAH17364.1| 743|Homo sapiens transducin-like enhance... 61 3e-09 AL445252-6|CAI13647.1| 322|Homo sapiens transducin-like enhance... 61 4e-09 AL358975-8|CAI13737.1| 322|Homo sapiens transducin-like enhance... 61 4e-09 AL353813-7|CAI41317.1| 322|Homo sapiens transducin-like enhance... 61 4e-09 M99435-1|AAA61192.1| 770|Homo sapiens transducin-like enhancer ... 58 3e-08 BC015747-1|AAH15747.1| 770|Homo sapiens transducin-like enhance... 58 3e-08 BC010100-1|AAH10100.1| 770|Homo sapiens transducin-like enhance... 58 3e-08 AL365190-3|CAI14978.1| 242|Homo sapiens transducin-like enhance... 58 3e-08 AL365190-2|CAI14977.1| 770|Homo sapiens transducin-like enhance... 58 3e-08 AL353682-2|CAI12596.1| 242|Homo sapiens transducin-like enhance... 58 3e-08 AL353682-1|CAI12595.1| 770|Homo sapiens transducin-like enhance... 58 3e-08 AB209854-1|BAD93091.1| 636|Homo sapiens transducin-like enhance... 58 3e-08 U04241-1|AAA16223.1| 197|Homo sapiens protein ( Human homolog o... 50 8e-06 AF072902-1|AAC35517.1| 196|Homo sapiens gp130 associated protei... 50 8e-06 AC005944-1|AAC72103.1| 197|Homo sapiens GRG_HUMAN protein. 50 8e-06 U88832-1|AAD00654.1| 197|Homo sapiens groucho protein homolog p... 48 4e-05 BC113737-1|AAI13738.1| 264|Homo sapiens amino-terminal enhancer... 46 2e-04 BC113735-1|AAI13736.1| 264|Homo sapiens amino-terminal enhancer... 46 2e-04 X73358-1|CAA51768.1| 185|Homo sapiens AES-1 protein. 43 0.001 BC035974-1|AAH35974.1| 795|Homo sapiens DEAH (Asp-Glu-Ala-His) ... 32 1.7 AF279891-1|AAF90182.1| 795|Homo sapiens dead box protein 15 pro... 32 1.7 AB001636-1|BAA23987.1| 813|Homo sapiens ATP-dependent RNA helic... 32 1.7 AB011174-1|BAA25528.1| 962|Homo sapiens KIAA0602 protein protein. 30 9.1 >M99438-1|AAA61194.1| 772|Homo sapiens transducin-like enhancer protein protein. Length = 772 Score = 71.3 bits (167), Expect = 3e-12 Identities = 35/55 (63%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +3 Query: 234 RHPGPPQPGQP-IKFTVGESCDRIKEEFNFLQAQYHK*VH*YIKLANKSISNYPH 395 RHP P QPGQP KFTV ESCDRIK+EF FLQAQYH Y KLAN+ H Sbjct: 6 RHPAPHQPGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRH 60 >BC043247-1|AAH43247.1| 767|Homo sapiens TLE3 protein protein. Length = 767 Score = 71.3 bits (167), Expect = 3e-12 Identities = 35/55 (63%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +3 Query: 234 RHPGPPQPGQP-IKFTVGESCDRIKEEFNFLQAQYHK*VH*YIKLANKSISNYPH 395 RHP P QPGQP KFTV ESCDRIK+EF FLQAQYH Y KLAN+ H Sbjct: 6 RHPAPHQPGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRH 60 >AY583460-1|AAS90946.1| 767|Homo sapiens transducin-like enhancer of split 3 splice variant 2 protein. Length = 767 Score = 71.3 bits (167), Expect = 3e-12 Identities = 35/55 (63%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +3 Query: 234 RHPGPPQPGQP-IKFTVGESCDRIKEEFNFLQAQYHK*VH*YIKLANKSISNYPH 395 RHP P QPGQP KFTV ESCDRIK+EF FLQAQYH Y KLAN+ H Sbjct: 6 RHPAPHQPGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRH 60 >AY583459-1|AAS90945.1| 764|Homo sapiens transducin-like enhancer of split 3 splice variant 1 protein. Length = 764 Score = 71.3 bits (167), Expect = 3e-12 Identities = 35/55 (63%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +3 Query: 234 RHPGPPQPGQP-IKFTVGESCDRIKEEFNFLQAQYHK*VH*YIKLANKSISNYPH 395 RHP P QPGQP KFTV ESCDRIK+EF FLQAQYH Y KLAN+ H Sbjct: 6 RHPAPHQPGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRH 60 >AB046767-1|BAB13373.1| 863|Homo sapiens KIAA1547 protein protein. Length = 863 Score = 71.3 bits (167), Expect = 3e-12 Identities = 35/55 (63%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +3 Query: 234 RHPGPPQPGQP-IKFTVGESCDRIKEEFNFLQAQYHK*VH*YIKLANKSISNYPH 395 RHP P QPGQP KFTV ESCDRIK+EF FLQAQYH Y KLAN+ H Sbjct: 109 RHPAPHQPGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRH 163 >BC059405-1|AAH59405.2| 805|Homo sapiens TLE4 protein protein. Length = 805 Score = 68.9 bits (161), Expect = 2e-11 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +3 Query: 234 RHPGPPQPGQPIKFTVGESCDRIKEEFNFLQAQYH 338 RHP P QP QP KFT+ ESCDRIKEEF FLQAQYH Sbjct: 13 RHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYH 47 >BC045650-1|AAH45650.1| 704|Homo sapiens TLE4 protein protein. Length = 704 Score = 68.9 bits (161), Expect = 2e-11 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +3 Query: 234 RHPGPPQPGQPIKFTVGESCDRIKEEFNFLQAQYH 338 RHP P QP QP KFT+ ESCDRIKEEF FLQAQYH Sbjct: 13 RHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYH 47 >AL445252-3|CAI13644.1| 764|Homo sapiens transducin-like enhancer of split 4 (E(sp1) homolog, Drosophila) protein. Length = 764 Score = 68.9 bits (161), Expect = 2e-11 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +3 Query: 234 RHPGPPQPGQPIKFTVGESCDRIKEEFNFLQAQYH 338 RHP P QP QP KFT+ ESCDRIKEEF FLQAQYH Sbjct: 13 RHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYH 47 >AL445252-2|CAI13643.1| 213|Homo sapiens transducin-like enhancer of split 4 (E(sp1) homolog, Drosophila) protein. Length = 213 Score = 68.9 bits (161), Expect = 2e-11 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +3 Query: 234 RHPGPPQPGQPIKFTVGESCDRIKEEFNFLQAQYH 338 RHP P QP QP KFT+ ESCDRIKEEF FLQAQYH Sbjct: 13 RHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYH 47 >AL445252-1|CAI13642.1| 128|Homo sapiens transducin-like enhancer of split 4 (E(sp1) homolog, Drosophila) protein. Length = 128 Score = 68.9 bits (161), Expect = 2e-11 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +3 Query: 234 RHPGPPQPGQPIKFTVGESCDRIKEEFNFLQAQYH 338 RHP P QP QP KFT+ ESCDRIKEEF FLQAQYH Sbjct: 13 RHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYH 47 >AL358975-5|CAC22599.1| 101|Homo sapiens transducin-like enhancer of split 4 (E(sp1) homolog, Drosophila) protein. Length = 101 Score = 68.9 bits (161), Expect = 2e-11 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +3 Query: 234 RHPGPPQPGQPIKFTVGESCDRIKEEFNFLQAQYH 338 RHP P QP QP KFT+ ESCDRIKEEF FLQAQYH Sbjct: 13 RHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYH 47 >AL358975-4|CAC22598.1| 91|Homo sapiens transducin-like enhancer of split 4 (E(sp1) homolog, Drosophila) protein. Length = 91 Score = 68.9 bits (161), Expect = 2e-11 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +3 Query: 234 RHPGPPQPGQPIKFTVGESCDRIKEEFNFLQAQYH 338 RHP P QP QP KFT+ ESCDRIKEEF FLQAQYH Sbjct: 13 RHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYH 47 >AL358975-3|CAI13734.1| 764|Homo sapiens transducin-like enhancer of split 4 (E(sp1) homolog, Drosophila) protein. Length = 764 Score = 68.9 bits (161), Expect = 2e-11 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +3 Query: 234 RHPGPPQPGQPIKFTVGESCDRIKEEFNFLQAQYH 338 RHP P QP QP KFT+ ESCDRIKEEF FLQAQYH Sbjct: 13 RHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYH 47 >AL358975-2|CAI13733.1| 213|Homo sapiens transducin-like enhancer of split 4 (E(sp1) homolog, Drosophila) protein. Length = 213 Score = 68.9 bits (161), Expect = 2e-11 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +3 Query: 234 RHPGPPQPGQPIKFTVGESCDRIKEEFNFLQAQYH 338 RHP P QP QP KFT+ ESCDRIKEEF FLQAQYH Sbjct: 13 RHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYH 47 >AL358975-1|CAI13732.1| 128|Homo sapiens transducin-like enhancer of split 4 (E(sp1) homolog, Drosophila) protein. Length = 128 Score = 68.9 bits (161), Expect = 2e-11 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +3 Query: 234 RHPGPPQPGQPIKFTVGESCDRIKEEFNFLQAQYH 338 RHP P QP QP KFT+ ESCDRIKEEF FLQAQYH Sbjct: 13 RHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYH 47 >AL353813-5|CAI41315.1| 764|Homo sapiens transducin-like enhancer of split 4 (E(sp1) homolog, Drosophila) protein. Length = 764 Score = 68.9 bits (161), Expect = 2e-11 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +3 Query: 234 RHPGPPQPGQPIKFTVGESCDRIKEEFNFLQAQYH 338 RHP P QP QP KFT+ ESCDRIKEEF FLQAQYH Sbjct: 13 RHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYH 47 >AL353813-4|CAI41314.1| 213|Homo sapiens transducin-like enhancer of split 4 (E(sp1) homolog, Drosophila) protein. Length = 213 Score = 68.9 bits (161), Expect = 2e-11 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +3 Query: 234 RHPGPPQPGQPIKFTVGESCDRIKEEFNFLQAQYH 338 RHP P QP QP KFT+ ESCDRIKEEF FLQAQYH Sbjct: 13 RHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYH 47 >AL353813-3|CAI41313.1| 128|Homo sapiens transducin-like enhancer of split 4 (E(sp1) homolog, Drosophila) protein. Length = 128 Score = 68.9 bits (161), Expect = 2e-11 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +3 Query: 234 RHPGPPQPGQPIKFTVGESCDRIKEEFNFLQAQYH 338 RHP P QP QP KFT+ ESCDRIKEEF FLQAQYH Sbjct: 13 RHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYH 47 >AB033087-1|BAA86575.1| 787|Homo sapiens KIAA1261 protein protein. Length = 787 Score = 68.9 bits (161), Expect = 2e-11 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +3 Query: 234 RHPGPPQPGQPIKFTVGESCDRIKEEFNFLQAQYH 338 RHP P QP QP KFT+ ESCDRIKEEF FLQAQYH Sbjct: 27 RHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYH 61 >BC041831-1|AAH41831.1| 772|Homo sapiens TLE3 protein protein. Length = 772 Score = 63.3 bits (147), Expect = 8e-10 Identities = 32/51 (62%), Positives = 34/51 (66%), Gaps = 1/51 (1%) Frame = +3 Query: 246 PPQPGQP-IKFTVGESCDRIKEEFNFLQAQYHK*VH*YIKLANKSISNYPH 395 P QPGQP KFTV ESCDRIK+EF FLQAQYH Y KLAN+ H Sbjct: 16 PHQPGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRH 66 >AL445252-5|CAI13646.1| 195|Homo sapiens transducin-like enhancer of split 4 (E(sp1) homolog, Drosophila) protein. Length = 195 Score = 61.7 bits (143), Expect = 2e-09 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = +3 Query: 234 RHPGPPQPGQPIKFTVGESCDRIKEEFNFLQAQYH 338 R P QP QP KFT+ ESCDRIKEEF FLQAQYH Sbjct: 11 RFRAPHQPAQPFKFTISESCDRIKEEFQFLQAQYH 45 >AL445252-4|CAI13645.1| 161|Homo sapiens transducin-like enhancer of split 4 (E(sp1) homolog, Drosophila) protein. Length = 161 Score = 61.7 bits (143), Expect = 2e-09 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = +3 Query: 234 RHPGPPQPGQPIKFTVGESCDRIKEEFNFLQAQYH 338 R P QP QP KFT+ ESCDRIKEEF FLQAQYH Sbjct: 11 RFRAPHQPAQPFKFTISESCDRIKEEFQFLQAQYH 45 >AL358975-7|CAI13736.1| 195|Homo sapiens transducin-like enhancer of split 4 (E(sp1) homolog, Drosophila) protein. Length = 195 Score = 61.7 bits (143), Expect = 2e-09 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = +3 Query: 234 RHPGPPQPGQPIKFTVGESCDRIKEEFNFLQAQYH 338 R P QP QP KFT+ ESCDRIKEEF FLQAQYH Sbjct: 11 RFRAPHQPAQPFKFTISESCDRIKEEFQFLQAQYH 45 >AL358975-6|CAI13735.1| 161|Homo sapiens transducin-like enhancer of split 4 (E(sp1) homolog, Drosophila) protein. Length = 161 Score = 61.7 bits (143), Expect = 2e-09 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = +3 Query: 234 RHPGPPQPGQPIKFTVGESCDRIKEEFNFLQAQYH 338 R P QP QP KFT+ ESCDRIKEEF FLQAQYH Sbjct: 11 RFRAPHQPAQPFKFTISESCDRIKEEFQFLQAQYH 45 >AL353813-6|CAI41316.1| 195|Homo sapiens transducin-like enhancer of split 4 (E(sp1) homolog, Drosophila) protein. Length = 195 Score = 61.7 bits (143), Expect = 2e-09 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = +3 Query: 234 RHPGPPQPGQPIKFTVGESCDRIKEEFNFLQAQYH 338 R P QP QP KFT+ ESCDRIKEEF FLQAQYH Sbjct: 11 RFRAPHQPAQPFKFTISESCDRIKEEFQFLQAQYH 45 >M99436-1|AAA61193.1| 743|Homo sapiens transducin-like enhancer protein protein. Length = 743 Score = 61.3 bits (142), Expect = 3e-09 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = +3 Query: 234 RHPGPPQPGQPIKFTVGESCDRIKEEFNFLQAQYH 338 RHP P Q GQP KF++ E CDRIKEEF FLQAQYH Sbjct: 6 RHPTPLQSGQPFKFSILEICDRIKEEFQFLQAQYH 40 >BC017364-1|AAH17364.1| 743|Homo sapiens transducin-like enhancer of split 2 (E(sp1) homolog, Drosophila) protein. Length = 743 Score = 61.3 bits (142), Expect = 3e-09 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = +3 Query: 234 RHPGPPQPGQPIKFTVGESCDRIKEEFNFLQAQYH 338 RHP P Q GQP KF++ E CDRIKEEF FLQAQYH Sbjct: 6 RHPTPLQSGQPFKFSILEICDRIKEEFQFLQAQYH 40 >AL445252-6|CAI13647.1| 322|Homo sapiens transducin-like enhancer of split 4 (E(sp1) homolog, Drosophila) protein. Length = 322 Score = 60.9 bits (141), Expect = 4e-09 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +3 Query: 246 PPQPGQPIKFTVGESCDRIKEEFNFLQAQYH 338 P QP QP KFT+ ESCDRIKEEF FLQAQYH Sbjct: 2 PHQPAQPFKFTISESCDRIKEEFQFLQAQYH 32 >AL358975-8|CAI13737.1| 322|Homo sapiens transducin-like enhancer of split 4 (E(sp1) homolog, Drosophila) protein. Length = 322 Score = 60.9 bits (141), Expect = 4e-09 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +3 Query: 246 PPQPGQPIKFTVGESCDRIKEEFNFLQAQYH 338 P QP QP KFT+ ESCDRIKEEF FLQAQYH Sbjct: 2 PHQPAQPFKFTISESCDRIKEEFQFLQAQYH 32 >AL353813-7|CAI41317.1| 322|Homo sapiens transducin-like enhancer of split 4 (E(sp1) homolog, Drosophila) protein. Length = 322 Score = 60.9 bits (141), Expect = 4e-09 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +3 Query: 246 PPQPGQPIKFTVGESCDRIKEEFNFLQAQYH 338 P QP QP KFT+ ESCDRIKEEF FLQAQYH Sbjct: 2 PHQPAQPFKFTISESCDRIKEEFQFLQAQYH 32 >M99435-1|AAA61192.1| 770|Homo sapiens transducin-like enhancer protein protein. Length = 770 Score = 58.0 bits (134), Expect = 3e-08 Identities = 27/36 (75%), Positives = 28/36 (77%), Gaps = 1/36 (2%) Frame = +3 Query: 234 RHPGPPQP-GQPIKFTVGESCDRIKEEFNFLQAQYH 338 RHP P Q GQP KFT+ ES DRIKEEF FLQAQYH Sbjct: 6 RHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYH 41 >BC015747-1|AAH15747.1| 770|Homo sapiens transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) protein. Length = 770 Score = 58.0 bits (134), Expect = 3e-08 Identities = 27/36 (75%), Positives = 28/36 (77%), Gaps = 1/36 (2%) Frame = +3 Query: 234 RHPGPPQP-GQPIKFTVGESCDRIKEEFNFLQAQYH 338 RHP P Q GQP KFT+ ES DRIKEEF FLQAQYH Sbjct: 6 RHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYH 41 >BC010100-1|AAH10100.1| 770|Homo sapiens transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) protein. Length = 770 Score = 58.0 bits (134), Expect = 3e-08 Identities = 27/36 (75%), Positives = 28/36 (77%), Gaps = 1/36 (2%) Frame = +3 Query: 234 RHPGPPQP-GQPIKFTVGESCDRIKEEFNFLQAQYH 338 RHP P Q GQP KFT+ ES DRIKEEF FLQAQYH Sbjct: 6 RHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYH 41 >AL365190-3|CAI14978.1| 242|Homo sapiens transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) protein. Length = 242 Score = 58.0 bits (134), Expect = 3e-08 Identities = 27/36 (75%), Positives = 28/36 (77%), Gaps = 1/36 (2%) Frame = +3 Query: 234 RHPGPPQP-GQPIKFTVGESCDRIKEEFNFLQAQYH 338 RHP P Q GQP KFT+ ES DRIKEEF FLQAQYH Sbjct: 6 RHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYH 41 >AL365190-2|CAI14977.1| 770|Homo sapiens transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) protein. Length = 770 Score = 58.0 bits (134), Expect = 3e-08 Identities = 27/36 (75%), Positives = 28/36 (77%), Gaps = 1/36 (2%) Frame = +3 Query: 234 RHPGPPQP-GQPIKFTVGESCDRIKEEFNFLQAQYH 338 RHP P Q GQP KFT+ ES DRIKEEF FLQAQYH Sbjct: 6 RHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYH 41 >AL353682-2|CAI12596.1| 242|Homo sapiens transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) protein. Length = 242 Score = 58.0 bits (134), Expect = 3e-08 Identities = 27/36 (75%), Positives = 28/36 (77%), Gaps = 1/36 (2%) Frame = +3 Query: 234 RHPGPPQP-GQPIKFTVGESCDRIKEEFNFLQAQYH 338 RHP P Q GQP KFT+ ES DRIKEEF FLQAQYH Sbjct: 6 RHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYH 41 >AL353682-1|CAI12595.1| 770|Homo sapiens transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) protein. Length = 770 Score = 58.0 bits (134), Expect = 3e-08 Identities = 27/36 (75%), Positives = 28/36 (77%), Gaps = 1/36 (2%) Frame = +3 Query: 234 RHPGPPQP-GQPIKFTVGESCDRIKEEFNFLQAQYH 338 RHP P Q GQP KFT+ ES DRIKEEF FLQAQYH Sbjct: 6 RHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYH 41 >AB209854-1|BAD93091.1| 636|Homo sapiens transducin-like enhancer protein 1 variant protein. Length = 636 Score = 58.0 bits (134), Expect = 3e-08 Identities = 27/36 (75%), Positives = 28/36 (77%), Gaps = 1/36 (2%) Frame = +3 Query: 234 RHPGPPQP-GQPIKFTVGESCDRIKEEFNFLQAQYH 338 RHP P Q GQP KFT+ ES DRIKEEF FLQAQYH Sbjct: 33 RHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYH 68 >U04241-1|AAA16223.1| 197|Homo sapiens protein ( Human homolog of Drosophila enhancer of split m9/m10 mRNA, complete cds. ). Length = 197 Score = 50.0 bits (114), Expect = 8e-06 Identities = 21/35 (60%), Positives = 24/35 (68%) Frame = +3 Query: 234 RHPGPPQPGQPIKFTVGESCDRIKEEFNFLQAQYH 338 RH G Q +KFT +SCDRIK+EF LQAQYH Sbjct: 7 RHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYH 41 >AF072902-1|AAC35517.1| 196|Homo sapiens gp130 associated protein GAM protein. Length = 196 Score = 50.0 bits (114), Expect = 8e-06 Identities = 21/35 (60%), Positives = 24/35 (68%) Frame = +3 Query: 234 RHPGPPQPGQPIKFTVGESCDRIKEEFNFLQAQYH 338 RH G Q +KFT +SCDRIK+EF LQAQYH Sbjct: 6 RHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYH 40 >AC005944-1|AAC72103.1| 197|Homo sapiens GRG_HUMAN protein. Length = 197 Score = 50.0 bits (114), Expect = 8e-06 Identities = 21/35 (60%), Positives = 24/35 (68%) Frame = +3 Query: 234 RHPGPPQPGQPIKFTVGESCDRIKEEFNFLQAQYH 338 RH G Q +KFT +SCDRIK+EF LQAQYH Sbjct: 7 RHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYH 41 >U88832-1|AAD00654.1| 197|Homo sapiens groucho protein homolog protein. Length = 197 Score = 47.6 bits (108), Expect = 4e-05 Identities = 20/35 (57%), Positives = 23/35 (65%) Frame = +3 Query: 234 RHPGPPQPGQPIKFTVGESCDRIKEEFNFLQAQYH 338 RH G Q +KFT +SCDRI +EF LQAQYH Sbjct: 7 RHSGSSHLPQQLKFTTSDSCDRITDEFQLLQAQYH 41 >BC113737-1|AAI13738.1| 264|Homo sapiens amino-terminal enhancer of split protein. Length = 264 Score = 45.6 bits (103), Expect = 2e-04 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = +3 Query: 261 QPIKFTVGESCDRIKEEFNFLQAQYH 338 Q +KFT +SCDRIK+EF LQAQYH Sbjct: 83 QQLKFTTSDSCDRIKDEFQLLQAQYH 108 >BC113735-1|AAI13736.1| 264|Homo sapiens amino-terminal enhancer of split protein. Length = 264 Score = 45.6 bits (103), Expect = 2e-04 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = +3 Query: 261 QPIKFTVGESCDRIKEEFNFLQAQYH 338 Q +KFT +SCDRIK+EF LQAQYH Sbjct: 83 QQLKFTTSDSCDRIKDEFQLLQAQYH 108 >X73358-1|CAA51768.1| 185|Homo sapiens AES-1 protein. Length = 185 Score = 43.2 bits (97), Expect = 0.001 Identities = 17/26 (65%), Positives = 20/26 (76%) Frame = +3 Query: 261 QPIKFTVGESCDRIKEEFNFLQAQYH 338 Q +KFT +SCDRI +EF LQAQYH Sbjct: 4 QQLKFTTSDSCDRITDEFQLLQAQYH 29 >BC035974-1|AAH35974.1| 795|Homo sapiens DEAH (Asp-Glu-Ala-His) box polypeptide 15 protein. Length = 795 Score = 32.3 bits (70), Expect = 1.7 Identities = 18/48 (37%), Positives = 24/48 (50%) Frame = -1 Query: 151 HGLH*TNIGHSTHCTRSTEQHSTRSVARGSPSQRQAAHVLTLVPNSAR 8 H H T+ HSTH T S HST + G S Q + T +P++ R Sbjct: 81 HSAHSTHSAHSTHSTHSA--HSTHAGHAGHTSLPQCINPFTNLPHTPR 126 >AF279891-1|AAF90182.1| 795|Homo sapiens dead box protein 15 protein. Length = 795 Score = 32.3 bits (70), Expect = 1.7 Identities = 18/48 (37%), Positives = 24/48 (50%) Frame = -1 Query: 151 HGLH*TNIGHSTHCTRSTEQHSTRSVARGSPSQRQAAHVLTLVPNSAR 8 H H T+ HSTH T S HST + G S Q + T +P++ R Sbjct: 81 HSAHSTHSAHSTHSTHSA--HSTHAGHAGHTSLPQCINPFTNLPHTPR 126 >AB001636-1|BAA23987.1| 813|Homo sapiens ATP-dependent RNA helicase #46 protein. Length = 813 Score = 32.3 bits (70), Expect = 1.7 Identities = 18/48 (37%), Positives = 24/48 (50%) Frame = -1 Query: 151 HGLH*TNIGHSTHCTRSTEQHSTRSVARGSPSQRQAAHVLTLVPNSAR 8 H H T+ HSTH T S HST + G S Q + T +P++ R Sbjct: 81 HSAHSTHSAHSTHSTHSA--HSTHAGHAGHTSLPQCINPFTNLPHTPR 126 >AB011174-1|BAA25528.1| 962|Homo sapiens KIAA0602 protein protein. Length = 962 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 501 DQMLVYKQQDLKMDHLGFGLSPXSATSYRTCPF 599 + ML YKQ+ K H F LSP +S + PF Sbjct: 716 EAMLTYKQKRKKHFHFDFTLSPDEESSQKFIPF 748 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,972,298 Number of Sequences: 237096 Number of extensions: 1778330 Number of successful extensions: 4610 Number of sequences better than 10.0: 49 Number of HSP's better than 10.0 without gapping: 4456 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4605 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8063224416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -