BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0656 (750 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 27 0.25 AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 22 5.3 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 7.1 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 26.6 bits (56), Expect = 0.25 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 631 TYELIIRALRXAGDLNQATEVLSNMKAQNLPATE 732 +Y+LI R G N TEV+ N + +++P T+ Sbjct: 132 SYKLIGRIAAGEGRFNTNTEVVINTEVKSIPVTK 165 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 22.2 bits (45), Expect = 5.3 Identities = 12/47 (25%), Positives = 23/47 (48%) Frame = -1 Query: 651 SYDQLISSDVRFYRQHFVDKCSHYDCSIICYISLQQLIVMIHLKFRM 511 +Y +L+ D+RF H V + II I ++++I + R+ Sbjct: 22 NYTELLPIDMRFNEGHIVSIVFYSVLMIISAIGNTTVLILITCRKRV 68 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.8 bits (44), Expect = 7.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 244 STEFLKNTDRMSSEELLEKLIAGLSTDI 327 S + + + SSEE L++ I L TDI Sbjct: 344 SNQIVSDNSLSSSEEKLKQDILNLRTDI 371 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,296 Number of Sequences: 438 Number of extensions: 3269 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -