BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0649 (569 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_954| Best HMM Match : Cys_knot (HMM E-Value=3.1) 30 1.2 SB_38465| Best HMM Match : Nitrophorin (HMM E-Value=0.75) 30 1.5 SB_25986| Best HMM Match : Myosin_head (HMM E-Value=1.4e-17) 29 2.7 SB_36131| Best HMM Match : His_leader (HMM E-Value=2.7e-10) 28 4.7 SB_50155| Best HMM Match : SPRY (HMM E-Value=7.7e-14) 28 6.2 >SB_954| Best HMM Match : Cys_knot (HMM E-Value=3.1) Length = 614 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -3 Query: 225 FCVRTFEGHTVVEKESFEPNKCLSKCAVPSAHKQAT 118 FC + G+T V+ ES PN C S PS +T Sbjct: 575 FCQKISTGNTQVQPESLSPNICCSHLPQPSCVSPST 610 >SB_38465| Best HMM Match : Nitrophorin (HMM E-Value=0.75) Length = 1167 Score = 29.9 bits (64), Expect = 1.5 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -3 Query: 225 FCVRTFEGHTVVEKESFEPNKCLSKCAVPSAHKQAT 118 FC + G+T V+ ES PN C S PS +T Sbjct: 1093 FCQKISTGNTQVQPESLPPNICCSHLPQPSCVSTST 1128 >SB_25986| Best HMM Match : Myosin_head (HMM E-Value=1.4e-17) Length = 1189 Score = 29.1 bits (62), Expect = 2.7 Identities = 20/45 (44%), Positives = 23/45 (51%) Frame = +2 Query: 188 STTVCPSKVLTQK*RSYTTNKENCCAEHKPDVTWPTFESKLVRIV 322 S VC SK TQ Y+ K EHKPDV WP+ + LV V Sbjct: 384 SVAVCWSKE-TQL-SIYSLVKTAKDIEHKPDVVWPSAQPILVSTV 426 >SB_36131| Best HMM Match : His_leader (HMM E-Value=2.7e-10) Length = 416 Score = 28.3 bits (60), Expect = 4.7 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 155 PSAQSLQLTNKRHHVCAVVVSIHRHH 78 PS+ S+ + + HH + ++ IH HH Sbjct: 144 PSSSSIIIIHHHHHPSSSIIIIHHHH 169 >SB_50155| Best HMM Match : SPRY (HMM E-Value=7.7e-14) Length = 453 Score = 27.9 bits (59), Expect = 6.2 Identities = 16/49 (32%), Positives = 29/49 (59%), Gaps = 5/49 (10%) Frame = -1 Query: 179 VSNQTNVFPSAQSLQLTNKR--HHVCAVVVS---IHRHHNEWLQNFE*K 48 + +QTNV+P+A+ ++ N R H + AV+V+ + + E +N E K Sbjct: 231 ILDQTNVYPNARRRKMNNFRGFHRIAAVLVTTNEVLKERTERRENLEGK 279 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,220,072 Number of Sequences: 59808 Number of extensions: 295773 Number of successful extensions: 720 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 652 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 720 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1349364063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -