BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0647 (430 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_06_0244 + 21822811-21823246,21823337-21823468,21823949-218240... 27 4.9 01_06_0554 + 30179641-30179658,30179725-30180126,30180580-301808... 27 4.9 >09_06_0244 + 21822811-21823246,21823337-21823468,21823949-21824037, 21824135-21824224,21825033-21825603,21826097-21826734, 21826978-21827098,21827223-21827337,21828234-21829723, 21829830-21829901,21830151-21830196,21830413-21830515, 21830591-21830674,21831035-21831475,21831651-21831746, 21831896-21832045,21832131-21832274,21832414-21832527, 21832621-21832803,21832901-21832945,21833058-21833192 Length = 1764 Score = 27.5 bits (58), Expect = 4.9 Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = +3 Query: 273 DAPSR-EHSLFMDSTCCCSVVRSCM 344 DAP+ E S + D CCCS+ C+ Sbjct: 747 DAPNNTECSPYRDGKCCCSLAPKCL 771 >01_06_0554 + 30179641-30179658,30179725-30180126,30180580-30180892, 30180966-30181358,30181442-30182427 Length = 703 Score = 27.5 bits (58), Expect = 4.9 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -1 Query: 364 QRKHHNFMQDLTTLQQQVESIKSECSRLGASYA 266 ++K HN ++T LQQ +E K E +L A Sbjct: 599 KKKLHNLQDEITGLQQSLEMKKDEMQKLAHQVA 631 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,329,765 Number of Sequences: 37544 Number of extensions: 48516 Number of successful extensions: 229 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 223 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 229 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 802495716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -