BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0645 (750 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 25 2.5 U50479-1|AAA93478.1| 151|Anopheles gambiae protein ( Anopheles ... 25 3.3 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 25.0 bits (52), Expect = 2.5 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -2 Query: 662 RRHFTTISKVHKMYGIDISYS 600 R HF +SK+ K +GID+ ++ Sbjct: 191 RVHFKEVSKLLKQHGIDLDHN 211 >U50479-1|AAA93478.1| 151|Anopheles gambiae protein ( Anopheles gambiae putativeribosomal protein S13 mRNA, complete cds. ). Length = 151 Score = 24.6 bits (51), Expect = 3.3 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = +2 Query: 218 LNRLKGQGVEDISISLPEQKVSVKS--TLSADDLLEIIKKTGKK 343 + R+ G +LP ++ SV S LSA+D+ E IKK GKK Sbjct: 1 MGRMHAPGKGISKSALPYRR-SVPSWLKLSAEDVKEQIKKLGKK 43 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 770,019 Number of Sequences: 2352 Number of extensions: 16065 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77339358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -