BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0641 (367 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 0.98 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 0.98 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 21 5.2 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.0 bits (47), Expect = 0.98 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = -1 Query: 286 IYIYSINIRQRLSIFVIYFGIEIVFYFFAQI 194 +YI + + +F+I+F + +V FFA + Sbjct: 1273 VYITYLQLEPIGFVFLIFFALLMVIQFFAMM 1303 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.0 bits (47), Expect = 0.98 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = -1 Query: 286 IYIYSINIRQRLSIFVIYFGIEIVFYFFAQI 194 +YI + + +F+I+F + +V FFA + Sbjct: 1273 VYITYLQLEPIGFVFLIFFALLMVIQFFAMM 1303 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 20.6 bits (41), Expect = 5.2 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -1 Query: 271 INIRQRLSIFVIYFGIEIVFY 209 I I Q ++ FVI+ + IVF+ Sbjct: 37 IGIVQTVAYFVIFIILTIVFF 57 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 76,052 Number of Sequences: 336 Number of extensions: 1316 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 7510735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -