BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0641 (367 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U01134-1|AAC50060.1| 687|Homo sapiens soluble vascular endothel... 30 2.0 BC039007-1|AAH39007.1| 687|Homo sapiens FLT1 protein protein. 30 2.0 Z96050-1|CAI19033.1| 1406|Homo sapiens chromosome 1 open reading... 29 6.0 Z94054-1|CAI19459.1| 1406|Homo sapiens chromosome 1 open reading... 29 6.0 AF097535-1|AAF04619.1| 1405|Homo sapiens membrane protein CH1 pr... 29 6.0 >U01134-1|AAC50060.1| 687|Homo sapiens soluble vascular endothelial cell growth factor receptor protein. Length = 687 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +3 Query: 57 ACMLDPVYTTTSYLKKKSVTVTFENCKRQI*HFEKRKRKNTR 182 AC VYT L+KK +T+ E+C ++ K K+TR Sbjct: 635 ACRARNVYTGEEILQKKEITIRGEHCNKKAVFSRISKFKSTR 676 >BC039007-1|AAH39007.1| 687|Homo sapiens FLT1 protein protein. Length = 687 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +3 Query: 57 ACMLDPVYTTTSYLKKKSVTVTFENCKRQI*HFEKRKRKNTR 182 AC VYT L+KK +T+ E+C ++ K K+TR Sbjct: 635 ACRARNVYTGEEILQKKEITIRGEHCNKKAVFSRISKFKSTR 676 >Z96050-1|CAI19033.1| 1406|Homo sapiens chromosome 1 open reading frame 9 protein. Length = 1406 Score = 28.7 bits (61), Expect = 6.0 Identities = 9/26 (34%), Positives = 21/26 (80%) Frame = +3 Query: 171 KNTRPFNFICAKK*NTISIPKYITKI 248 +++RPF+ +C+K+ N+ ++PK I+ + Sbjct: 38 RHSRPFHELCSKEENSATVPKLISLV 63 >Z94054-1|CAI19459.1| 1406|Homo sapiens chromosome 1 open reading frame 9 protein. Length = 1406 Score = 28.7 bits (61), Expect = 6.0 Identities = 9/26 (34%), Positives = 21/26 (80%) Frame = +3 Query: 171 KNTRPFNFICAKK*NTISIPKYITKI 248 +++RPF+ +C+K+ N+ ++PK I+ + Sbjct: 38 RHSRPFHELCSKEENSATVPKLISLV 63 >AF097535-1|AAF04619.1| 1405|Homo sapiens membrane protein CH1 protein. Length = 1405 Score = 28.7 bits (61), Expect = 6.0 Identities = 9/26 (34%), Positives = 21/26 (80%) Frame = +3 Query: 171 KNTRPFNFICAKK*NTISIPKYITKI 248 +++RPF+ +C+K+ N+ ++PK I+ + Sbjct: 38 RHSRPFHELCSKEENSATVPKLISLV 63 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 43,780,763 Number of Sequences: 237096 Number of extensions: 666335 Number of successful extensions: 2172 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2168 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2172 length of database: 76,859,062 effective HSP length: 81 effective length of database: 57,654,286 effective search space used: 2306171440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -