BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0641 (367 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY052115-1|AAK93539.1| 1358|Drosophila melanogaster SD06557p pro... 28 3.3 AE014296-2810|AAF49404.2| 1734|Drosophila melanogaster CG9715-PA... 28 3.3 >AY052115-1|AAK93539.1| 1358|Drosophila melanogaster SD06557p protein. Length = 1358 Score = 28.3 bits (60), Expect = 3.3 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +3 Query: 6 ESHSILVSGTEPP*HRPACMLDPVYTTTSYLKKKSVTVTFENCK 137 E S++ S T PP H P+C V ++ ++ +K T C+ Sbjct: 17 EGTSVVASSTTPPMHSPSC---SVMSSDDFIVQKDTTRLLTECE 57 >AE014296-2810|AAF49404.2| 1734|Drosophila melanogaster CG9715-PA protein. Length = 1734 Score = 28.3 bits (60), Expect = 3.3 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +3 Query: 6 ESHSILVSGTEPP*HRPACMLDPVYTTTSYLKKKSVTVTFENCK 137 E S++ S T PP H P+C V ++ ++ +K T C+ Sbjct: 393 EGTSVVASSTTPPMHSPSC---SVMSSDDFIVQKDTTRLLTECE 433 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,484,701 Number of Sequences: 53049 Number of extensions: 204665 Number of successful extensions: 348 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 348 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 348 length of database: 24,988,368 effective HSP length: 76 effective length of database: 20,956,644 effective search space used: 943048980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -