BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0640 (750 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q7JRL9 Cluster: GH25289p; n=7; Endopterygota|Rep: GH252... 70 7e-11 UniRef50_Q6MMR8 Cluster: Putative uncharacterized protein precur... 33 7.5 UniRef50_O86945 Cluster: Sub-unit I of an aa3-type cytochrome ox... 33 9.9 >UniRef50_Q7JRL9 Cluster: GH25289p; n=7; Endopterygota|Rep: GH25289p - Drosophila melanogaster (Fruit fly) Length = 219 Score = 69.7 bits (163), Expect = 7e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +2 Query: 2 NCDLGMLKSLGIKDSELGDVKFFLEKLVNTGFLD 103 N DLGMLKSLGIKDSELGDVKFFLEKLVNTGFLD Sbjct: 186 NGDLGMLKSLGIKDSELGDVKFFLEKLVNTGFLD 219 >UniRef50_Q6MMR8 Cluster: Putative uncharacterized protein precursor; n=1; Bdellovibrio bacteriovorus|Rep: Putative uncharacterized protein precursor - Bdellovibrio bacteriovorus Length = 220 Score = 33.1 bits (72), Expect = 7.5 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -3 Query: 286 SPRGFLVVKQVYHTHSHWDQERDLLSPESYGVIGQVAIE 170 +P+G L + YH H W + +DL S S G + A+E Sbjct: 162 TPKGSLFLHLGYHLHKQWVRRKDLNSLSSLGALPATALE 200 >UniRef50_O86945 Cluster: Sub-unit I of an aa3-type cytochrome oxidase; n=1; Acidithiobacillus ferrooxidans|Rep: Sub-unit I of an aa3-type cytochrome oxidase - Thiobacillus ferrooxidans (Acidithiobacillus ferrooxidans) Length = 627 Score = 32.7 bits (71), Expect = 9.9 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 1/70 (1%) Frame = -2 Query: 245 SFSLGSGKGFTFS*ILWSHRAGSYRRRSLWGQSGQQSSIQRPTP-VLFSQGNRC*PVSPG 69 SF LG+G + +L+S R G + WG +G + I+ PTP V + G V P Sbjct: 549 SFFLGAGFLIPLANLLYSWRYGPKAEANPWGSNGLEWQIKSPTPYVPYPAGTEPEVVGPN 608 Query: 68 KT*RLRVQNP 39 ++P Sbjct: 609 DNYAAEAKDP 618 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 730,681,437 Number of Sequences: 1657284 Number of extensions: 14636763 Number of successful extensions: 37575 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 36293 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37527 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 61734884250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -