BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0637 (700 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 2.8 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 22 6.4 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.0 bits (47), Expect = 2.8 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 287 EVLPHGRIFFPPSLSSCRRQ 346 +VLP+G + FPP + RQ Sbjct: 53 QVLPNGNLVFPPFRAEDYRQ 72 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.8 bits (44), Expect = 6.4 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Frame = +3 Query: 468 DSGDYEMILGY-RAQ---HSTHRTPTKGGIRFSTDVTRDEV 578 ++ DY M +G RA+ HS+ + G+ F VTRD V Sbjct: 417 ENTDYFMPIGRPRAKDYGHSSGSVIDRNGVMFFNMVTRDSV 457 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,057 Number of Sequences: 438 Number of extensions: 3767 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -