BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0636 (750 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_59547| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_11649| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 29.1 bits (62), Expect = 4.0 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 640 SVFGLNCQSGYTGETKPPCFDXVLSWMNFP 729 SV+ +N GYT + P D +SW + P Sbjct: 434 SVYSVNMSVGYTEKNADPGIDIAISWNSLP 463 >SB_59547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1516 Score = 28.3 bits (60), Expect = 7.0 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = +2 Query: 353 DCGTWYKYPEYFKSRHLLFRRQHSFTK*KRICYLRSLLPRPI-RF*ENSPQGWLG 514 D TWY Y + + +L Q SFT +LL RPI R+ +PQ W G Sbjct: 98 DMETWYCYGDEITNAKMLQAYQSSFT--------MTLLQRPIARYVRLNPQAWNG 144 >SB_11649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 755 Score = 28.3 bits (60), Expect = 7.0 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 529 PIWSTPQPTLWRVLSEPNGTR 467 P W QP +W +L EP +R Sbjct: 151 PFWVKYQPRIWAILEEPRSSR 171 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,836,057 Number of Sequences: 59808 Number of extensions: 433591 Number of successful extensions: 932 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 864 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 927 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -