BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0636 (750 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 24 1.3 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 24 1.3 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 24 1.8 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 23 2.3 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 23 4.0 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 24.2 bits (50), Expect = 1.3 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = +3 Query: 366 GTSTLNILNPDIFFFAANIVL 428 GT+TL++ N DI +N+++ Sbjct: 172 GTATLDVYNADIMAATSNVII 192 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 24.2 bits (50), Expect = 1.3 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = +3 Query: 366 GTSTLNILNPDIFFFAANIVL 428 GT+TL++ N DI +N+++ Sbjct: 172 GTATLDVYNADIMAATSNVII 192 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 23.8 bits (49), Expect = 1.8 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 34 VHQGTMSASNGKNNFSNRS 90 +H+G S NG NN S RS Sbjct: 307 IHRGRGSVHNGSNNGSPRS 325 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 23.4 bits (48), Expect = 2.3 Identities = 8/24 (33%), Positives = 16/24 (66%) Frame = +3 Query: 663 VWLYW*NKTPLL*XGFVLDEFSDV 734 +WL N++P++ G+ + +F DV Sbjct: 67 IWLSPINRSPMVDFGYDISDFKDV 90 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = -1 Query: 300 SASHRNKIN*KKKTPLYLRLELTTKQQTS 214 +ASH N++N + K + + ++ ++ QTS Sbjct: 1143 TASHANQLNRQGKQVIQTQYQVVSQAQTS 1171 Score = 21.4 bits (43), Expect = 9.3 Identities = 9/51 (17%), Positives = 26/51 (50%) Frame = -1 Query: 750 LALTPGRRKIHPRQNPVKAGGFCFTSITRLAVQAKDARLAKTRDQGHYESS 598 + +TP +++I Q+P+ T+ + ++ ++ + T D+ + S+ Sbjct: 195 IRITPAKKRIKLEQSPLCPPAPRLTNSNSIKHESDNSDYSHTTDENRHSST 245 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,660 Number of Sequences: 438 Number of extensions: 4170 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -