BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0635 (750 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g12100.1 68416.m01506 cation efflux family protein / metal to... 29 3.3 >At3g12100.1 68416.m01506 cation efflux family protein / metal tolerance protein, putative member of the cation diffusion facilitator (CDF) family, or cation efflux (CE) family, PMID:11500563 Length = 393 Score = 29.1 bits (62), Expect = 3.3 Identities = 10/31 (32%), Positives = 20/31 (64%) Frame = +3 Query: 225 FFGQTSDISISHSSVLFVIW*LWNIVLKSNK 317 FFG+ D+ ++ SVL ++W ++ +V N+ Sbjct: 79 FFGEGKDVDMAKVSVLEMVWEVFGVVTSGNR 109 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,104,584 Number of Sequences: 28952 Number of extensions: 208254 Number of successful extensions: 273 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 269 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 273 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1663169840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -