SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brP-0630
         (700 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY873915-1|AAW67571.2|  384|Tribolium castaneum chitinase 16 pro...    23   3.2  
AY873914-1|AAW67570.1|  384|Tribolium castaneum chitinase 3 prot...    23   3.2  
DQ659249-1|ABG47447.1|  383|Tribolium castaneum chitinase 9 prot...    22   4.2  
DQ855501-1|ABH88188.1|  146|Tribolium castaneum chemosensory pro...    22   5.5  
AY887136-1|AAW78361.1|  580|Tribolium castaneum vasa RNA helicas...    21   7.3  

>AY873915-1|AAW67571.2|  384|Tribolium castaneum chitinase 16
           protein.
          Length = 384

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = +3

Query: 105 PKKVNLGVGAY 137
           P K+NLG+G+Y
Sbjct: 255 PSKINLGLGSY 265


>AY873914-1|AAW67570.1|  384|Tribolium castaneum chitinase 3
           protein.
          Length = 384

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = +3

Query: 105 PKKVNLGVGAY 137
           P K+NLG+G+Y
Sbjct: 255 PSKINLGLGSY 265


>DQ659249-1|ABG47447.1|  383|Tribolium castaneum chitinase 9
           protein.
          Length = 383

 Score = 22.2 bits (45), Expect = 4.2
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +3

Query: 105 PKKVNLGVGAY 137
           P K+NLG+G Y
Sbjct: 254 PSKINLGLGTY 264


>DQ855501-1|ABH88188.1|  146|Tribolium castaneum chemosensory
           protein 15 protein.
          Length = 146

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 7/14 (50%), Positives = 11/14 (78%)
 Frame = -2

Query: 276 KQV*LQHQYMWPHH 235
           ++V LQH + +PHH
Sbjct: 123 EEVKLQHLHQFPHH 136


>AY887136-1|AAW78361.1|  580|Tribolium castaneum vasa RNA helicase
           protein.
          Length = 580

 Score = 21.4 bits (43), Expect = 7.3
 Identities = 11/32 (34%), Positives = 13/32 (40%)
 Frame = +3

Query: 144 DEGKPFVLPSVRKAEEILHSRGLNHEYAPISG 239
           D+GK F   S  K   I      NH+   I G
Sbjct: 253 DQGKKFAYNSTVKVAVIYGGTSTNHQRGRILG 284


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 190,991
Number of Sequences: 336
Number of extensions: 4845
Number of successful extensions: 7
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18426585
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -