BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0629 (650 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 22 3.8 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 6.7 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 8.8 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 22.2 bits (45), Expect = 3.8 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +2 Query: 35 NNDSNSRRANQPINTAH*VSRWIFSV 112 N N ++AN PI+T H W++ + Sbjct: 82 NYCDNKQQANPPISTEH--CDWLYGI 105 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.4 bits (43), Expect = 6.7 Identities = 15/55 (27%), Positives = 24/55 (43%) Frame = +1 Query: 313 RLRLNAINPMRYVYV*CGRFTTCKVVIIFLMHTSISISEPRHLKIESTRQAFLQQ 477 RL N +N V GRFT K + + + S + PR L+ + L++ Sbjct: 155 RLMSNNLNKNNVVAT--GRFTFHKKNLYYSFYISDKAARPRSLQFVDSEGNILEE 207 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.0 bits (42), Expect = 8.8 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -1 Query: 176 TNTSPSKSSASQGLPP 129 T ++PS ++ + GLPP Sbjct: 259 TGSAPSPTAGAGGLPP 274 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,080 Number of Sequences: 336 Number of extensions: 2865 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -