BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0629 (650 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB17E12.07c |sen2||tRNA-splicing endonuclease subunit Sen2|Sc... 30 0.25 SPBC4F6.06 |kin1||microtubule affinity-regulating kinase Kin1 |S... 27 2.3 >SPAPB17E12.07c |sen2||tRNA-splicing endonuclease subunit Sen2|Schizosaccharomyces pombe|chr 1|||Manual Length = 380 Score = 30.3 bits (65), Expect = 0.25 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = +3 Query: 285 KVKWQCQIITSSIECY*SDAICICVMWPFYYMQSRDNFFNAYVH*HFRTKAS 440 +V+WQCQ+ S + C +D+ I W + + N + H RTK S Sbjct: 46 QVQWQCQLHESDLSCVVTDSEAIKKFWTSGFF-GKGNLSRSEPTWHTRTKRS 96 >SPBC4F6.06 |kin1||microtubule affinity-regulating kinase Kin1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 891 Score = 27.1 bits (57), Expect = 2.3 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = -1 Query: 218 RAAR*SHGLSLREFTNTSPSKSSASQGLPPDRNRDSLRKSSEKLN 84 R A HG TN + + G P D+N S KS++KL+ Sbjct: 704 RGASLGHGRMSTSTTNRQKQILNETMGNPVDKNSTSPSKSTDKLD 748 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,469,253 Number of Sequences: 5004 Number of extensions: 46932 Number of successful extensions: 100 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 95 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 100 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -