BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0629 (650 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1648 - 35036538-35037155 31 0.80 03_02_0450 + 8600078-8600351,8600944-8601037,8601094-8601241,860... 29 2.4 >04_04_1648 - 35036538-35037155 Length = 205 Score = 31.1 bits (67), Expect = 0.80 Identities = 13/43 (30%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = -1 Query: 485 TCICCKNACLVDSIFRCLGSEML-MDVCIKKIITTLHVVKRPH 360 +C+CC CL +F CL S ++ + V + + +++ RPH Sbjct: 9 SCLCCPCKCLACGLFSCLCSILISLLVTLGVLALIFYLIFRPH 51 >03_02_0450 + 8600078-8600351,8600944-8601037,8601094-8601241, 8602226-8602396,8602779-8602958,8603148-8603177, 8603925-8604707 Length = 559 Score = 29.5 bits (63), Expect = 2.4 Identities = 23/55 (41%), Positives = 29/55 (52%) Frame = -2 Query: 220 YARLGDLTGSA*ENLLILALARAVLHKVYHRIGIATH*ENPARNSMGCVYGLVRS 56 +AR GDLT + ENLL + + VL V G+ + ENP SM V LV S Sbjct: 445 FARSGDLTVADVENLL-NSYKQLVLKYVALSQGMGINLENPPVQSMQTVSDLVES 498 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,260,274 Number of Sequences: 37544 Number of extensions: 282426 Number of successful extensions: 595 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 576 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 595 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -