BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0629 (650 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_45406| Best HMM Match : 7tm_2 (HMM E-Value=5.9) 28 7.6 SB_10643| Best HMM Match : ShTK (HMM E-Value=2.9e-23) 28 7.6 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = -1 Query: 104 KSSEKLNGLCLWVGSLVENLSHCLPSKEYILK 9 KSS L GL ++ SL+ENL+H + + ++K Sbjct: 237 KSSSSLKGLWIFTVSLLENLAHQISTVSVVIK 268 >SB_45406| Best HMM Match : 7tm_2 (HMM E-Value=5.9) Length = 225 Score = 27.9 bits (59), Expect = 7.6 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +3 Query: 342 AICICVMWPFYYMQSRDNFFNAYVH 416 A+ I +WP YY++ +D F V+ Sbjct: 69 ALVISALWPGYYIKGKDGFMGLQVY 93 >SB_10643| Best HMM Match : ShTK (HMM E-Value=2.9e-23) Length = 2123 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = -1 Query: 203 SHGLSLREFTNTSPSKSSASQGLPPDRNRDSLRKSSEKLNG 81 ++G S +F +PS S ASQG PD N++++ NG Sbjct: 709 ANGESASKFGTGTPSNSEASQG-NPDANQENITGKMTGKNG 748 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,258,552 Number of Sequences: 59808 Number of extensions: 350337 Number of successful extensions: 793 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 734 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 793 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -