BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0622 (750 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) 50 2e-06 SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) 40 0.002 SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) 40 0.003 SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) 31 1.00 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_36629| Best HMM Match : Fer2 (HMM E-Value=0.0041) 28 9.3 SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 >SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 52.4 bits (120), Expect = 4e-07 Identities = 31/57 (54%), Positives = 33/57 (57%), Gaps = 2/57 (3%) Frame = +1 Query: 577 KRSWDTMKGVGRS*QX--GXWPWEVRNPLKECAXTHLPKQPXLKMDGAETFCLYTTV 741 +RS D KGVG S Q G W NP KEC THLPKQ LKMDGA+ LY V Sbjct: 14 RRSSDPTKGVGCSRQQDGGHGSW---NPAKECVTTHLPKQLALKMDGAQASHLYRAV 67 >SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 50.4 bits (115), Expect = 2e-06 Identities = 31/57 (54%), Positives = 33/57 (57%), Gaps = 2/57 (3%) Frame = +1 Query: 577 KRSWDTMKGVGRS*QX--GXWPWEVRNPLKECAXTHLPKQPXLKMDGAETFCLYTTV 741 +RS D KGVG S Q G W NPLKEC T LPKQ LKMDGA+ LY V Sbjct: 14 RRSSDPTKGVGCSRQQDGGHGSW---NPLKECVTTPLPKQLALKMDGAQASHLYRAV 67 >SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) Length = 212 Score = 50.0 bits (114), Expect = 2e-06 Identities = 22/39 (56%), Positives = 26/39 (66%) Frame = +1 Query: 625 GXWPWEVRNPLKECAXTHLPKQPXLKMDGAETFCLYTTV 741 G WPW++ + KEC THLPKQ LKMDGA+ LY V Sbjct: 3 GRWPWKLESA-KECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 50.0 bits (114), Expect = 2e-06 Identities = 22/39 (56%), Positives = 26/39 (66%) Frame = +1 Query: 625 GXWPWEVRNPLKECAXTHLPKQPXLKMDGAETFCLYTTV 741 G WPW++ + KEC THLPKQ LKMDGA+ LY V Sbjct: 3 GRWPWKLESA-KECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 50.0 bits (114), Expect = 2e-06 Identities = 22/39 (56%), Positives = 26/39 (66%) Frame = +1 Query: 625 GXWPWEVRNPLKECAXTHLPKQPXLKMDGAETFCLYTTV 741 G WPW++ + KEC THLPKQ LKMDGA+ LY V Sbjct: 82 GRWPWKLESA-KECVTTHLPKQLALKMDGAQASHLYRAV 119 >SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 45.6 bits (103), Expect = 4e-05 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -1 Query: 255 NRYGPPSGFPLXST*PGIVHHLSGPSICA 169 NRY PP FPL S GIVHHLSGP+ CA Sbjct: 1 NRYEPPPEFPLASPYSGIVHHLSGPNRCA 29 >SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/42 (52%), Positives = 26/42 (61%) Frame = -1 Query: 567 INXTFGSSHSASXAYQNWPXWHRHQISGFIVRVSRSSXPFKV 442 +N FGSS AS AYQ WP + H +SGF SR+S FKV Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGFNY-ASRTSYQFKV 57 >SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = -3 Query: 256 ESLRSSIRVSPXFDLTRHSSPSFGSQHLCS 167 ESLR+S RVS F L RHSSPSFGSQ + S Sbjct: 35 ESLRASTRVSSGFTLFRHSSPSFGSQQMRS 64 >SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = +1 Query: 658 KECAXTHLPKQPXLKMDGAETFCLYTTV 741 KEC THLPKQ LKMDGA+ LY V Sbjct: 7 KECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = +1 Query: 658 KECAXTHLPKQPXLKMDGAETFCLYTTV 741 KEC THLPKQ LKMDGA+ LY V Sbjct: 7 KECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = +1 Query: 658 KECAXTHLPKQPXLKMDGAETFCLYTTV 741 KEC THLPKQ LKMDGA+ LY V Sbjct: 7 KECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = +1 Query: 658 KECAXTHLPKQPXLKMDGAETFCLYTTV 741 KEC THLPKQ LKMDGA+ LY V Sbjct: 14 KECVTTHLPKQLALKMDGAQASHLYRAV 41 >SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = +1 Query: 658 KECAXTHLPKQPXLKMDGAETFCLYTTV 741 KEC THLPKQ LKMDGA+ LY V Sbjct: 7 KECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = +1 Query: 658 KECAXTHLPKQPXLKMDGAETFCLYTTV 741 KEC THLPKQ LKMDGA+ LY V Sbjct: 7 KECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = +1 Query: 658 KECAXTHLPKQPXLKMDGAETFCLYTTV 741 KEC THLPKQ LKMDGA+ LY V Sbjct: 7 KECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = +1 Query: 658 KECAXTHLPKQPXLKMDGAETFCLYTTV 741 KEC THLPKQ LKMDGA+ LY V Sbjct: 7 KECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = +1 Query: 658 KECAXTHLPKQPXLKMDGAETFCLYTTV 741 KEC THLPKQ LKMDGA+ LY V Sbjct: 7 KECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = +1 Query: 658 KECAXTHLPKQPXLKMDGAETFCLYTTV 741 KEC THLPKQ LKMDGA+ LY V Sbjct: 7 KECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) Length = 93 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = +1 Query: 658 KECAXTHLPKQPXLKMDGAETFCLYTTV 741 KEC THLPKQ LKMDGA+ LY V Sbjct: 7 KECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = +1 Query: 658 KECAXTHLPKQPXLKMDGAETFCLYTTV 741 KEC THLPKQ LKMDGA+ LY V Sbjct: 13 KECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = +1 Query: 658 KECAXTHLPKQPXLKMDGAETFCLYTTV 741 KEC THLPKQ LKMDGA+ LY V Sbjct: 7 KECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = +1 Query: 658 KECAXTHLPKQPXLKMDGAETFCLYTTV 741 KEC THLPKQ LKMDGA+ LY V Sbjct: 7 KECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = +1 Query: 658 KECAXTHLPKQPXLKMDGAETFCLYTTV 741 KEC THLPKQ LKMDGA+ LY V Sbjct: 7 KECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = +1 Query: 658 KECAXTHLPKQPXLKMDGAETFCLYTTV 741 KEC THLPKQ LKMDGA+ LY V Sbjct: 7 KECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = +1 Query: 658 KECAXTHLPKQPXLKMDGAETFCLYTTV 741 KEC THLPKQ LKMDGA+ LY V Sbjct: 7 KECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = +1 Query: 658 KECAXTHLPKQPXLKMDGAETFCLYTTV 741 KEC THLPKQ LKMDGA+ LY V Sbjct: 7 KECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = +1 Query: 658 KECAXTHLPKQPXLKMDGAETFCLYTTV 741 KEC THLPKQ LKMDGA+ LY V Sbjct: 13 KECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = -1 Query: 567 INXTFGSSHSASXAYQNWPXWHRHQISGF 481 +N FGSS AS AYQ WP + H +SGF Sbjct: 57 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 85 Score = 33.5 bits (73), Expect = 0.19 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = -3 Query: 730 IGKTFQRHPFSGLVASAGESXHTPSADSE 644 IG T +RHPFSGLVASA + TP S+ Sbjct: 24 IGATLERHPFSGLVASAEQP--TPFVGSD 50 >SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = -1 Query: 567 INXTFGSSHSASXAYQNWPXWHRHQISGF 481 +N FGSS AS AYQ WP + H +SGF Sbjct: 54 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 82 >SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = -1 Query: 567 INXTFGSSHSASXAYQNWPXWHRHQISGF 481 +N FGSS AS AYQ WP + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = -1 Query: 567 INXTFGSSHSASXAYQNWPXWHRHQISGF 481 +N FGSS AS AYQ WP + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = -1 Query: 567 INXTFGSSHSASXAYQNWPXWHRHQISGF 481 +N FGSS AS AYQ WP + H +SGF Sbjct: 55 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 83 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = -2 Query: 662 SFSGFRTSXGHXPCCHERPTPFMVSHERXL 573 +F G R GH C E+PTPF+ S ER L Sbjct: 24 NFKGRRERTGHHKKC-EQPTPFVGSDERRL 52 >SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = -1 Query: 567 INXTFGSSHSASXAYQNWPXWHRHQISGF 481 +N FGSS AS AYQ WP + H +SGF Sbjct: 55 LNRAFGSSRIASSAYQKWPTSNSHSLSGF 83 Score = 33.5 bits (73), Expect = 0.19 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = -3 Query: 730 IGKTFQRHPFSGLVASAGESXHTPSADSE 644 IG T +RHPFSGLVASA + TP S+ Sbjct: 22 IGATLERHPFSGLVASAEQP--TPFVGSD 48 >SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = -1 Query: 567 INXTFGSSHSASXAYQNWPXWHRHQISGF 481 +N FGSS AS AYQ WP + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = -1 Query: 567 INXTFGSSHSASXAYQNWPXWHRHQISGF 481 +N FGSS AS AYQ WP + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = -1 Query: 567 INXTFGSSHSASXAYQNWPXWHRHQISGF 481 +N FGSS AS AYQ WP + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTKNSHSLSGF 45 >SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = -1 Query: 567 INXTFGSSHSASXAYQNWPXWHRHQISGF 481 +N FGSS AS AYQ WP + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) Length = 125 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = -1 Query: 567 INXTFGSSHSASXAYQNWPXWHRHQISGF 481 +N FGSS AS AYQ WP + H +SGF Sbjct: 96 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 124 >SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = -1 Query: 567 INXTFGSSHSASXAYQNWPXWHRHQISGF 481 +N FGSS AS AYQ WP + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = -1 Query: 567 INXTFGSSHSASXAYQNWPXWHRHQISGF 481 +N FGSS AS AYQ WP + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = -1 Query: 567 INXTFGSSHSASXAYQNWPXWHRHQISGF 481 +N FGSS AS AYQ WP + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = -1 Query: 567 INXTFGSSHSASXAYQNWPXWHRHQISGF 481 +N FGSS AS AYQ WP + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = -1 Query: 567 INXTFGSSHSASXAYQNWPXWHRHQISGF 481 +N FGSS AS AYQ WP + H +SGF Sbjct: 17 LNHAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = -1 Query: 567 INXTFGSSHSASXAYQNWPXWHRHQISGF 481 +N FGSS AS AYQ WP + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = -1 Query: 567 INXTFGSSHSASXAYQNWPXWHRHQISGF 481 +N FGSS AS AYQ WP + H +SGF Sbjct: 139 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 167 >SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = -1 Query: 567 INXTFGSSHSASXAYQNWPXWHRHQISGF 481 +N +GSS AS AYQ WP + H +SGF Sbjct: 17 LNRAYGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 36.3 bits (80), Expect = 0.027 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -1 Query: 567 INXTFGSSHSASXAYQNWPXWHRHQISGF 481 +N FGSS AS A Q WP + H +SGF Sbjct: 74 LNRAFGSSRIASSALQKWPTRNSHSLSGF 102 >SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -1 Query: 567 INXTFGSSHSASXAYQNWPXWHRHQISGF 481 +N FGSS AS AYQ P + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKGPTRNSHSLSGF 45 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -1 Query: 567 INXTFGSSHSASXAYQNWPXWHRHQI 490 +N FGSS AS AYQ WP + H + Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSL 42 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 32.7 bits (71), Expect = 0.33 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -1 Query: 255 NRYGPPSGFPLXST*PGIVHH 193 NRY PP FPL S GIVHH Sbjct: 1 NRYEPPPEFPLASPYSGIVHH 21 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 305 ISLSPLYPVPTIDLHVR 255 ISLSPLYP TIDLHVR Sbjct: 38 ISLSPLYPNLTIDLHVR 54 >SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) Length = 276 Score = 31.1 bits (67), Expect = 1.00 Identities = 26/68 (38%), Positives = 34/68 (50%), Gaps = 7/68 (10%) Frame = -2 Query: 614 ERPTPFMVSHERXLGALTVRLVHPTAPVXLTKI-------GPXGTVIRSPASSFE*AGVL 456 E+PTPF+ S ER RL HP ++I GP T I P + + G+L Sbjct: 58 EQPTPFVGSDER-------RLWHPYRAFGSSRIASSGYQNGPTRTRIHCPGFNKQ-VGLL 109 Query: 455 XHLKFENR 432 +LKFENR Sbjct: 110 TNLKFENR 117 >SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -1 Query: 567 INXTFGSSHSASXAYQNWP 511 +N FGSS AS AYQ WP Sbjct: 17 LNRAFGSSRIASSAYQKWP 35 >SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +1 Query: 658 KECAXTHLPKQPXLKM 705 KEC THLPKQ LKM Sbjct: 7 KECVTTHLPKQLALKM 22 >SB_36629| Best HMM Match : Fer2 (HMM E-Value=0.0041) Length = 128 Score = 27.9 bits (59), Expect = 9.3 Identities = 15/54 (27%), Positives = 32/54 (59%), Gaps = 4/54 (7%) Frame = +3 Query: 123 LPRRLVSNQ*MKARSEHKC----WDPKDGELCLVRSXSGETLMEDRSDSDVQID 272 L RR VSN + +++H+ + +DG+ V++ G++L++ D+DV ++ Sbjct: 29 LARRYVSNGKEQTKAKHETVSITFVDRDGDRQTVKAKVGDSLLDVAKDNDVDLE 82 >SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 27.9 bits (59), Expect = 9.3 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -1 Query: 567 INXTFGSSHSASXAYQNWP 511 +N FGSS AS AYQN P Sbjct: 17 LNRAFGSSRIASSAYQNGP 35 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,489,713 Number of Sequences: 59808 Number of extensions: 429553 Number of successful extensions: 897 Number of sequences better than 10.0: 56 Number of HSP's better than 10.0 without gapping: 803 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 893 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -