BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0621 (650 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC26A3.09c |rga2||GTPase activating protein Rga2|Schizosacchar... 31 0.14 SPCC11E10.09c ||SPCC188.01c|alpha-amylase homolog |Schizosacchar... 25 9.5 >SPAC26A3.09c |rga2||GTPase activating protein Rga2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1275 Score = 31.1 bits (67), Expect = 0.14 Identities = 18/54 (33%), Positives = 26/54 (48%) Frame = -3 Query: 324 RLYKGECTSAKPAQLPRRSYDITWIASSS*HSSGTWYPSISLKLASGTAAVSSH 163 RL K E T + P+ P R+ + SS + G +P ISLK + S+H Sbjct: 115 RLSKYESTDSFPSSQPSRANSPQSDSYSSPYEKGKLFPKISLKSSKDVPTASAH 168 >SPCC11E10.09c ||SPCC188.01c|alpha-amylase homolog |Schizosaccharomyces pombe|chr 3|||Manual Length = 478 Score = 25.0 bits (52), Expect = 9.5 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +2 Query: 8 VVDFLKKYDFDGLDLD 55 V D +K+Y FDG+ LD Sbjct: 201 VSDLIKRYQFDGIRLD 216 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,594,638 Number of Sequences: 5004 Number of extensions: 53865 Number of successful extensions: 138 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 138 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -