BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0618 (750 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0584 - 24082867-24082960,24083071-24083191,24083693-240837... 108 5e-24 01_06_0888 + 32738275-32739567 30 2.3 >02_04_0584 - 24082867-24082960,24083071-24083191,24083693-24083786, 24084675-24084725 Length = 119 Score = 108 bits (259), Expect = 5e-24 Identities = 43/97 (44%), Positives = 67/97 (69%) Frame = +1 Query: 16 HTILLVQPGPRPETRTYSDYESVNDCMEGVCKIYEEHLKRRNPNTPTITYDISQLFDFVD 195 HTI+L+QP +RT+ DY S+N ++G+C +YE ++ NP P ITYDI+ L++F+D Sbjct: 21 HTIILMQPSQNRASRTFMDYNSINHALDGLCGLYERKIRDINPMVPNITYDITDLYNFID 80 Query: 196 QLADLSCLVYQKSTNTYAPYNKDWIKEKIYVLLRQAA 306 LAD+S LVY S + PY++ WIK+K++ L++ A Sbjct: 81 GLADISALVYDHSIQAFLPYDRQWIKQKLFQHLKKLA 117 >01_06_0888 + 32738275-32739567 Length = 430 Score = 29.9 bits (64), Expect = 2.3 Identities = 21/66 (31%), Positives = 35/66 (53%), Gaps = 2/66 (3%) Frame = +1 Query: 94 MEGVCKIYEEHLKRRNP--NTPTITYDISQLFDFVDQLADLSCLVYQKSTNTYAPYNKDW 267 + GVC+ + EHL+R P P + Y I L +QLA SC++ +T+ + + +W Sbjct: 31 LAGVCRPWREHLERLPPLLPPPKLPYLILPL---AEQLA-FSCVLSDCATHPF--FVPEW 84 Query: 268 IKEKIY 285 I+ Y Sbjct: 85 IRHACY 90 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,488,717 Number of Sequences: 37544 Number of extensions: 329476 Number of successful extensions: 675 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 663 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 675 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1992480932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -