BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0618 (750 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25364| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_41088| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_40683| Best HMM Match : VWD (HMM E-Value=2.4e-05) 29 5.3 SB_13923| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 >SB_25364| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/63 (25%), Positives = 31/63 (49%) Frame = +1 Query: 58 RTYSDYESVNDCMEGVCKIYEEHLKRRNPNTPTITYDISQLFDFVDQLADLSCLVYQKST 237 RT S YE + E IYE H + TP+I S +++ + + + +Y++++ Sbjct: 100 RTPSIYERTSSIYERTSSIYE-HTSSIHKRTPSIYERTSSIYERTPSIYERTPSIYERTS 158 Query: 238 NTY 246 + Y Sbjct: 159 SIY 161 >SB_41088| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 778 Score = 29.1 bits (62), Expect = 4.0 Identities = 18/57 (31%), Positives = 30/57 (52%) Frame = +3 Query: 480 VQHLALLFM*NHLHNVKTISPSHMQAVVNVCTLFKPIFDTFVVFLISCKIQTRTNSV 650 V +AL++M H K ++PS VN+ + F+P V++IS +Q T +V Sbjct: 543 VHFIALVYMVGH---AKRLTPSSSAVHVNLESKFEPTILNSTVYIISVALQLLTFAV 596 >SB_40683| Best HMM Match : VWD (HMM E-Value=2.4e-05) Length = 2200 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/48 (29%), Positives = 27/48 (56%) Frame = -3 Query: 442 SYQRIFPNIIISLLLYYVTQLCIFSSLHCTVFLMLSFFYNLNHSVRPL 299 +Y +I+ N IS YY+T+ +L+ T + + + + N S+RP+ Sbjct: 521 TYYKIYKNRTISA--YYMTRNMTLKALNVTRNMTIRYIKHFNSSIRPM 566 >SB_13923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 505 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +1 Query: 154 TITYDISQLFDFVDQLADLSCLVYQKSTNTYAPYNKDWIK 273 +I + + + DF DQ+A L Y++ N Y +N + K Sbjct: 272 SIRFPLMSMKDFTDQVARSGYLTYEEVANMYIGFNSGFQK 311 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,360,278 Number of Sequences: 59808 Number of extensions: 431513 Number of successful extensions: 1032 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 910 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1029 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -