BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0617 (539 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 24 0.86 DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. 24 1.1 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 23 2.0 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 23 2.0 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 23 2.0 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 23 2.0 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 8.1 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 24.2 bits (50), Expect = 0.86 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -2 Query: 145 YEKCLSNRMSVLIINVFENGIVFFFVFDLNMDIRIR 38 Y LSNRM +I N F V F + N+D +R Sbjct: 380 YMLALSNRMQKIINNDFNFNDVNFRILGANVDDLMR 415 >DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. Length = 152 Score = 23.8 bits (49), Expect = 1.1 Identities = 10/35 (28%), Positives = 22/35 (62%) Frame = -2 Query: 142 EKCLSNRMSVLIINVFENGIVFFFVFDLNMDIRIR 38 E CL +R++++ NVF+ ++ D +MD+ ++ Sbjct: 57 EACLFHRLALMNDNVFDVSKFDVYLNDTDMDMDLK 91 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 2.0 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +2 Query: 26 KLXASNSNIHVQIKYEKKNNSIFKNVNYQ 112 K+ +S SN + Y NN+ + N NY+ Sbjct: 80 KIISSLSNNYKYSNYNNYNNNNYNNNNYK 108 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 2.0 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +2 Query: 26 KLXASNSNIHVQIKYEKKNNSIFKNVNYQ 112 K+ +S SN + Y NN+ + N NY+ Sbjct: 80 KIISSLSNNYKYSNYNNYNNNNYNNNNYK 108 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 2.0 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +2 Query: 26 KLXASNSNIHVQIKYEKKNNSIFKNVNYQ 112 K+ +S SN + Y NN+ + N NY+ Sbjct: 80 KIISSLSNNYKYSNYNNYNNNNYNNNNYK 108 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 2.0 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +2 Query: 26 KLXASNSNIHVQIKYEKKNNSIFKNVNYQ 112 K+ +S SN + Y NN+ + N NY+ Sbjct: 80 KIISSLSNNYKYSNYNNYNNNNYNNNNYK 108 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.0 bits (42), Expect = 8.1 Identities = 8/35 (22%), Positives = 19/35 (54%) Frame = +1 Query: 178 SSFNDILIAVLYHLNYXXXXXXDMRLFYPLIFSEV 282 ++F ++ ++ +L+Y D R+F L F ++ Sbjct: 329 TTFLGLIRLIVLNLSYNMLTHIDARMFKDLFFLQI 363 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,914 Number of Sequences: 438 Number of extensions: 2392 Number of successful extensions: 18 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15336375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -