BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0615 (700 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 28 0.084 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 7.3 AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 21 7.3 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 7.3 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 7.3 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 7.3 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 7.3 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 7.3 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 7.3 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 7.3 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 21 9.7 AF263514-1|AAF74206.1| 127|Tribolium castaneum cytochrome P450 ... 21 9.7 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 27.9 bits (59), Expect = 0.084 Identities = 14/46 (30%), Positives = 20/46 (43%) Frame = +3 Query: 357 CSAGRVCEINEHGDAMCNCIKDCPYETDSRRMVCTNFNETWQSDCE 494 C G VC I++ G +C DCP T+ NE + C+ Sbjct: 385 CQNGGVCRISDGGGYIC----DCPSGTNGTNCEIDTINECDSNPCK 426 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 231 SLDEKRYHEAEIARV 275 SLDEK+Y E+ RV Sbjct: 334 SLDEKKYILQEVVRV 348 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 21.4 bits (43), Expect = 7.3 Identities = 8/31 (25%), Positives = 17/31 (54%) Frame = +1 Query: 529 LISGRGPQYHHVQIEYYGTCREMPDCTESEM 621 ++SG PQ + I +YG + D ++ ++ Sbjct: 241 ILSGADPQKLAIGIAFYGHAFTLVDASQHDL 271 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.4 bits (43), Expect = 7.3 Identities = 16/56 (28%), Positives = 20/56 (35%) Frame = +1 Query: 349 KSTAAQDVSAKSTNTETPCVTASRTVPTRQTPDAWCAQTSTKPGNRIAKYTASDAY 516 + A D S T T A V Q D W + G R+ ASDA+ Sbjct: 549 RGKALMDKSVMKKYT-TRSTQAKHYVQYDQGEDRWLCTLLLQRGYRVEYSAASDAF 603 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.3 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = +1 Query: 436 QTPDAWCAQTSTKPGNRIAKYTASDAY 516 Q D W + G R+ ASDAY Sbjct: 837 QGEDRWLCTLLLQRGYRVEYSAASDAY 863 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.3 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = +1 Query: 436 QTPDAWCAQTSTKPGNRIAKYTASDAY 516 Q D W + G R+ ASDAY Sbjct: 837 QGEDRWLCTLLLQRGYRVEYSAASDAY 863 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 7.3 Identities = 16/56 (28%), Positives = 20/56 (35%) Frame = +1 Query: 349 KSTAAQDVSAKSTNTETPCVTASRTVPTRQTPDAWCAQTSTKPGNRIAKYTASDAY 516 + A D S T T A V Q D W + G R+ ASDA+ Sbjct: 782 RGKALMDKSVMKKYT-TRSTQAKHYVQYDQGEDRWLCTLLLQRGYRVEYSAASDAF 836 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 7.3 Identities = 16/56 (28%), Positives = 20/56 (35%) Frame = +1 Query: 349 KSTAAQDVSAKSTNTETPCVTASRTVPTRQTPDAWCAQTSTKPGNRIAKYTASDAY 516 + A D S T T A V Q D W + G R+ ASDA+ Sbjct: 782 RGKALMDKSVMKKYT-TRSTQAKHYVQYDQGEDRWLCTLLLQRGYRVEYSAASDAF 836 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.3 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = +1 Query: 436 QTPDAWCAQTSTKPGNRIAKYTASDAY 516 Q D W + G R+ ASDAY Sbjct: 837 QGEDRWLCTLLLQRGYRVEYSAASDAY 863 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.3 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = +1 Query: 436 QTPDAWCAQTSTKPGNRIAKYTASDAY 516 Q D W + G R+ ASDAY Sbjct: 837 QGEDRWLCTLLLQRGYRVEYSAASDAY 863 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = -2 Query: 90 PRSXGPTQEDPSSC 49 P+ G Q DP SC Sbjct: 37 PQGGGAVQPDPGSC 50 >AF263514-1|AAF74206.1| 127|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 127 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 464 LQRNLAIGLRSIPPAMLMPRQL 529 L+R L LR PP ++ RQL Sbjct: 48 LERCLMETLRMFPPVPIIARQL 69 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,592 Number of Sequences: 336 Number of extensions: 3045 Number of successful extensions: 12 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -