BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0614 (795 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 27 0.88 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 27 0.88 DQ230894-1|ABD94313.1| 315|Anopheles gambiae zinc finger protei... 24 6.2 DQ230893-1|ABD94311.1| 315|Anopheles gambiae zinc finger protei... 24 6.2 AJ438610-3|CAD27475.1| 190|Anopheles gambiae putative RHO small... 23 8.2 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 26.6 bits (56), Expect = 0.88 Identities = 18/41 (43%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Frame = -3 Query: 508 RASLEVRASLFYEYDIQLLGRVTI---GETA*PITAARYHT 395 RASLE R SLF YDI R+ +A P+ YHT Sbjct: 216 RASLERRDSLFRPYDISKSPRLCSSNGSSSATPLPLHPYHT 256 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 26.6 bits (56), Expect = 0.88 Identities = 18/41 (43%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Frame = -3 Query: 508 RASLEVRASLFYEYDIQLLGRVTI---GETA*PITAARYHT 395 RASLE R SLF YDI R+ +A P+ YHT Sbjct: 216 RASLERRDSLFRPYDISKSPRLCSSNGSSSATPLPLHPYHT 256 >DQ230894-1|ABD94313.1| 315|Anopheles gambiae zinc finger protein 183 protein. Length = 315 Score = 23.8 bits (49), Expect = 6.2 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = +3 Query: 102 RSSPSWDGEGSSDERDSGISLGAEYRPQPERHPEEEDAHLKAEL 233 RSS + S +E +G+S ++ QPE P ++ A + E+ Sbjct: 59 RSSNADSSHSSEEEESAGLSYKSKRSAQPE-GPRDQGATAELEI 101 >DQ230893-1|ABD94311.1| 315|Anopheles gambiae zinc finger protein 183 protein. Length = 315 Score = 23.8 bits (49), Expect = 6.2 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = +3 Query: 102 RSSPSWDGEGSSDERDSGISLGAEYRPQPERHPEEEDAHLKAEL 233 RSS + S +E +G+S ++ QPE P ++ A + E+ Sbjct: 59 RSSNADSSHSSEEEESAGLSYKSKRSAQPE-GPRDQGATAELEI 101 >AJ438610-3|CAD27475.1| 190|Anopheles gambiae putative RHO small GTPase protein. Length = 190 Score = 23.4 bits (48), Expect = 8.2 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 527 KCVV*GSGVIGGTRVLI 477 KCVV G G +G T +LI Sbjct: 8 KCVVVGDGTVGKTCMLI 24 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 589,317 Number of Sequences: 2352 Number of extensions: 9810 Number of successful extensions: 20 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83576403 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -