BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0613 (700 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0103 - 773727-774737,774797-774813,774852-775078,777465-77... 29 4.7 02_05_0338 - 28084169-28084366,28084414-28085225,28085565-280855... 28 8.2 >01_01_0103 - 773727-774737,774797-774813,774852-775078,777465-778237 Length = 675 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = +3 Query: 54 ISRTIKRYLYVYHNIICI---LPIIYFFLNF 137 I+ + +YLYVYH + C+ L +Y+ L F Sbjct: 155 ITNSSSKYLYVYHPVDCLTTALSFVYYMLPF 185 >02_05_0338 - 28084169-28084366,28084414-28085225,28085565-28085595, 28085638-28086214,28086439-28087145,28087188-28087228, 28087253-28087366,28087517-28088108 Length = 1023 Score = 27.9 bits (59), Expect = 8.2 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -1 Query: 568 GVRCGGSFRFAIVDIKDRLVPFLC 497 G CGG FRF++ D ++ V +C Sbjct: 329 GYECGGMFRFSLSDFCNKSVNHIC 352 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,450,155 Number of Sequences: 37544 Number of extensions: 281163 Number of successful extensions: 679 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 655 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 679 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -