BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0613 (700 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 8.4 SB_54044| Best HMM Match : PARP (HMM E-Value=0.078) 28 8.4 >SB_57| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1498 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = -3 Query: 356 YKVFLFKFIFIXNVCVHVLGQNCK*TVVFIYSSLS 252 +++ L FI++ N C L + + TVVF Y ++S Sbjct: 50 FRIVLAGFIYLHNRCFQNLMETGESTVVFFYDAIS 84 >SB_54044| Best HMM Match : PARP (HMM E-Value=0.078) Length = 489 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +1 Query: 547 RNPRSGRRAALPRPSTDSTYRKTTALYTNRNRYYS 651 RN RSG + PST T+ +TNRN +YS Sbjct: 161 RNQRSGNHSY---PSTSGLQLYTSICHTNRNSHYS 192 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,206,935 Number of Sequences: 59808 Number of extensions: 332539 Number of successful extensions: 677 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 590 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 672 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -