BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0611 (600 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 25 0.65 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 2.6 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 21 6.0 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 24.6 bits (51), Expect = 0.65 Identities = 7/20 (35%), Positives = 15/20 (75%) Frame = +2 Query: 8 KVCCLILRLYPNIVLNLLKL 67 +VC ++++YP +V+N + L Sbjct: 168 EVCTFVVQVYPRLVVNTINL 187 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.6 bits (46), Expect = 2.6 Identities = 15/45 (33%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Frame = +3 Query: 438 LTASSRNLTSYVQQVSNKINSNESTMLVATA----TKSLSAGDVW 560 +T+ S TS SNK NS++ ML+ K + DVW Sbjct: 423 ITSPSNTNTSTSSTNSNKPNSSDLNMLIKETMPLPRKLVRGQDVW 467 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 21.4 bits (43), Expect = 6.0 Identities = 10/46 (21%), Positives = 17/46 (36%) Frame = +2 Query: 152 RLWGLDSQKXLRAAKVLIIGLSGLGAEIAKNVILTGVKSVCLLDNE 289 R W +D + + L I + K+ L +C L N+ Sbjct: 302 RAWAMDDESDINGTPPLHISGPAEAGPLTKDAGLLSYPEICTLLND 347 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,424 Number of Sequences: 336 Number of extensions: 2668 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15143945 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -