BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0610 (750 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g12570.1 68417.m01983 ubiquitin-protein ligase, putative simi... 28 5.8 >At4g12570.1 68417.m01983 ubiquitin-protein ligase, putative similar to SP|P39940 Ubiquitin--protein ligase RSP5 (EC 6.3.2.-) {Saccharomyces cerevisiae}; contains Pfam profiles PF00240: Ubiquitin family, PF00632: HECT-domain (ubiquitin-transferase) Length = 873 Score = 28.3 bits (60), Expect = 5.8 Identities = 21/95 (22%), Positives = 42/95 (44%), Gaps = 3/95 (3%) Frame = +2 Query: 206 LSNIIILYEEIKSTGNWNTEECKEYIKPLDKSFEILYGFPLDQILYINIFDKKDIFNVCI 385 L+ + I E+IK T CK+ ++ + F+ G L +L K+D +C Sbjct: 629 LAGLKISLEDIKDTDRIMYNSCKQILEMDPEFFDSNAGLGLTFVLETEELGKRDTIELCP 688 Query: 386 KILHEKITVDSLKKYPSL---XEVYSSLVEKVKEY 481 + + + K+Y L + ++E+VK++ Sbjct: 689 DGKLKAVNSKNRKQYVDLLIERRFATPILEQVKQF 723 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,833,260 Number of Sequences: 28952 Number of extensions: 219852 Number of successful extensions: 429 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 428 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 429 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1663169840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -