BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0606 (493 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10598| Best HMM Match : LRR_1 (HMM E-Value=4.4e-19) 29 1.6 SB_11067| Best HMM Match : RVT_1 (HMM E-Value=0) 29 1.6 >SB_10598| Best HMM Match : LRR_1 (HMM E-Value=4.4e-19) Length = 811 Score = 29.5 bits (63), Expect = 1.6 Identities = 22/47 (46%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -2 Query: 213 NCFFCLSSNIITELSQEPLLVRHNYIN*KCFLPF-INYLPNSYFTVV 76 NC CLSS II S E LL+ N I LP I LPN F V Sbjct: 156 NCLICLSSRIIELQSLEKLLLMENNIT---VLPAEIAKLPNLQFVNV 199 >SB_11067| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1176 Score = 29.5 bits (63), Expect = 1.6 Identities = 16/52 (30%), Positives = 27/52 (51%) Frame = +2 Query: 227 SYNLKNIVSGLNGAF*TIYDRFVHNDFIMFFYYLINDGKNCIKTKKYIVIKL 382 +Y L++ ++ NG F I + + DF++ Y ND + + K I IKL Sbjct: 151 NYQLQDTIADSNGRFLIIRCKIQNEDFLLINSYAPNDDASQVLLFKEIQIKL 202 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,523,338 Number of Sequences: 59808 Number of extensions: 168787 Number of successful extensions: 226 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 222 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 226 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1050596726 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -