BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0601 (650 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC13G6.01c |rad8|SPAC5H10.14c|ubiquitin-protein ligase E3 |Sch... 26 4.1 SPBC56F2.09c |arg5||arginine specific carbamoyl-phosphate syntha... 23 5.5 SPAC6C3.04 |cit1||citrate synthase|Schizosaccharomyces pombe|chr... 25 7.2 SPAC6F12.11c |sfc1||transcription factor TFIIIC complex A box as... 25 7.2 SPAC22H10.03c |kap114||karyopherin Kap14|Schizosaccharomyces pom... 25 9.5 >SPAC13G6.01c |rad8|SPAC5H10.14c|ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1133 Score = 26.2 bits (55), Expect = 4.1 Identities = 11/37 (29%), Positives = 16/37 (43%) Frame = +1 Query: 523 KIDALHEYVDRLFSTPDCGTAPVNMSTIVGTAHAFCG 633 KID L + + P C P+ ++ HA CG Sbjct: 863 KIDTLKSFEALITECPICCNEPIQNPLLLNCKHACCG 899 >SPBC56F2.09c |arg5||arginine specific carbamoyl-phosphate synthase Arg5 |Schizosaccharomyces pombe|chr 2|||Manual Length = 415 Score = 23.4 bits (48), Expect(2) = 5.5 Identities = 11/36 (30%), Positives = 16/36 (44%) Frame = -3 Query: 519 PMTTRGRVLHKYPVVNAGCSSTGLPLLTVGVGPRIH 412 P+T R+L K P + + LT+ GP H Sbjct: 22 PVTNHERILPKQPSFPTAPAQNEIATLTIRNGPIFH 57 Score = 20.6 bits (41), Expect(2) = 5.5 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -3 Query: 300 TTDPGGRVQNSLGPFYALPYKIFT 229 TT P G V++ P Y IFT Sbjct: 74 TTSPVGYVESLTDPSYKQQILIFT 97 >SPAC6C3.04 |cit1||citrate synthase|Schizosaccharomyces pombe|chr 1|||Manual Length = 473 Score = 25.4 bits (53), Expect = 7.2 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 296 RTLGGESRTVWDRFMLFPIK 237 RTLG S+ +WDR + PI+ Sbjct: 437 RTLGVASQLIWDRALGLPIE 456 >SPAC6F12.11c |sfc1||transcription factor TFIIIC complex A box associated subunit Sfc1|Schizosaccharomyces pombe|chr 1|||Manual Length = 456 Score = 25.4 bits (53), Expect = 7.2 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = +1 Query: 229 SKNFIGKSIKRSQTVLDSPPRVRRLLLFRQGADQSGDVSASSTVHVLNMSSTL 387 S+N + +IK+ + + R+R++ LFR AD S ++ V + STL Sbjct: 72 SRNDLLVTIKKMDNSVQNVSRIRQVFLFRDMAD--FQYSTQNSPFVQKLDSTL 122 >SPAC22H10.03c |kap114||karyopherin Kap14|Schizosaccharomyces pombe|chr 1|||Manual Length = 986 Score = 25.0 bits (52), Expect = 9.5 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -3 Query: 339 VTTLVRALTEQQQTTDPGGRVQNSLG 262 V + + L EQ Q+ DP R+Q LG Sbjct: 2 VESKIIKLLEQVQSADPNSRIQAELG 27 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,754,030 Number of Sequences: 5004 Number of extensions: 55626 Number of successful extensions: 122 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 122 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -