BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0600 (750 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 24 1.8 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 22 7.1 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 22 7.1 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 22 7.1 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 22 7.1 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 22 7.1 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 22 7.1 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 22 7.1 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 22 7.1 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 22 7.1 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 9.3 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 9.3 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 23.8 bits (49), Expect = 1.8 Identities = 15/58 (25%), Positives = 20/58 (34%) Frame = +1 Query: 298 WRLAAGECRPECPQNFFPWETSCRRCHHYCQDCHGAXPQKCTSCPPHFSLXDGLCVEC 471 W L +G C + + C C + H A C +CP H D EC Sbjct: 240 WYLPSGGCHCKPGYQADVEKQECTECP-IGKFKHEAGSHSCEACPAHSKSSDYGFTEC 296 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 7.1 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = +2 Query: 71 IKPPVNAHIAPTH 109 ++PP+N PTH Sbjct: 161 LRPPLNPRFGPTH 173 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 7.1 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = +2 Query: 71 IKPPVNAHIAPTH 109 ++PP+N PTH Sbjct: 161 LRPPLNPRFGPTH 173 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 7.1 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = +2 Query: 71 IKPPVNAHIAPTH 109 ++PP+N PTH Sbjct: 161 LRPPLNPRFGPTH 173 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 7.1 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = +2 Query: 71 IKPPVNAHIAPTH 109 ++PP+N PTH Sbjct: 161 LRPPLNPRFGPTH 173 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 7.1 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = +2 Query: 71 IKPPVNAHIAPTH 109 ++PP+N PTH Sbjct: 161 LRPPLNPRFGPTH 173 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 7.1 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = +2 Query: 71 IKPPVNAHIAPTH 109 ++PP+N PTH Sbjct: 161 LRPPLNPRFGPTH 173 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 7.1 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = +2 Query: 71 IKPPVNAHIAPTH 109 ++PP+N PTH Sbjct: 173 LRPPLNPRFGPTH 185 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 7.1 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = +2 Query: 71 IKPPVNAHIAPTH 109 ++PP+N PTH Sbjct: 173 LRPPLNPRFGPTH 185 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.8 bits (44), Expect = 7.1 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = +2 Query: 71 IKPPVNAHIAPTH 109 ++PP+N PTH Sbjct: 401 LRPPLNPRFGPTH 413 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 9.3 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -1 Query: 369 SAAGFPWKEVLWAL 328 SAAG P +V WAL Sbjct: 444 SAAGNPTPQVTWAL 457 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 9.3 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -1 Query: 369 SAAGFPWKEVLWAL 328 SAAG P +V WAL Sbjct: 444 SAAGNPTPQVTWAL 457 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 227,610 Number of Sequences: 438 Number of extensions: 5419 Number of successful extensions: 71 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -