Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brP-0599
         (749 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF080430-1|AAC28863.2|  208|Apis mellifera ribosomal protein S8 ...    23   2.3  
EF493864-1|ABP65286.1|  247|Apis mellifera triosephoshpate isome...    22   7.1  

>AF080430-1|AAC28863.2|  208|Apis mellifera ribosomal protein S8
           protein.
          Length = 208

 Score = 23.4 bits (48), Expect = 2.3
 Identities = 12/39 (30%), Positives = 19/39 (48%)
 Frame = -2

Query: 652 YESTIIKAGNVTFGQLLVNQKNEIIDFVFH*QSQNSXXR 536
           Y +  +  GN ++G     +K  IID V++  S N   R
Sbjct: 55  YRALRLDTGNFSWGSECTTRKTRIIDVVYN-ASNNELVR 92


>EF493864-1|ABP65286.1|  247|Apis mellifera triosephoshpate
           isomerase protein.
          Length = 247

 Score = 21.8 bits (44), Expect = 7.1
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = -1

Query: 614 WTIIGKSEKRN 582
           W I+G SE+RN
Sbjct: 89  WVILGHSERRN 99


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 166,980
Number of Sequences: 438
Number of extensions: 2828
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 23510295
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)