BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0599 (749 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 ... 23 2.3 EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isome... 22 7.1 >AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 protein. Length = 208 Score = 23.4 bits (48), Expect = 2.3 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = -2 Query: 652 YESTIIKAGNVTFGQLLVNQKNEIIDFVFH*QSQNSXXR 536 Y + + GN ++G +K IID V++ S N R Sbjct: 55 YRALRLDTGNFSWGSECTTRKTRIIDVVYN-ASNNELVR 92 >EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isomerase protein. Length = 247 Score = 21.8 bits (44), Expect = 7.1 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -1 Query: 614 WTIIGKSEKRN 582 W I+G SE+RN Sbjct: 89 WVILGHSERRN 99 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,980 Number of Sequences: 438 Number of extensions: 2828 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -