BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0598 (700 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43248| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_7193| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 >SB_43248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 871 Score = 29.1 bits (62), Expect = 3.6 Identities = 17/49 (34%), Positives = 26/49 (53%) Frame = -3 Query: 248 QKKIYTNASVFRIRQLVNISKALRQKNEANESFNKIPK*TKKHRMRFLQ 102 ++ + A + I LV K ++++ EA E+ KIP KKH R LQ Sbjct: 547 EEGVLEEAEFYSIEPLV---KMIKERIEAREASRKIPLQAKKHVYRVLQ 592 >SB_7193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 3/49 (6%) Frame = +1 Query: 130 VYFGILLNDSFASFFCLKALEILTS*---RIRNTDAFVYIFFCLXRWTS 267 ++ ++L SF SF C+ + + R RNT +YI F + W S Sbjct: 176 IFLSVILGASFFSFVCISVERMHATVWPLRHRNTKPRMYIVFIMITWLS 224 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,880,651 Number of Sequences: 59808 Number of extensions: 422252 Number of successful extensions: 707 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 611 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 707 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -