BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0598 (700 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein pro... 27 0.23 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 24 1.2 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 24 1.2 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 24 1.2 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 24 1.2 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 24 1.6 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 24 1.6 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 24 1.6 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 24 1.6 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 24 1.6 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 23 2.1 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 23 2.1 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 23 2.1 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 23 2.1 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 23 2.1 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 23 2.1 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 23 2.1 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 23 2.1 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 23 2.1 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 23 2.8 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 23 2.8 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 23 2.8 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 23 3.7 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 22 6.4 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 22 6.4 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 21 8.5 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 21 8.5 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 8.5 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 21 8.5 >L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein protein. Length = 81 Score = 26.6 bits (56), Expect = 0.23 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +2 Query: 581 KNHSCKINNNIPPKVTLNKMHINDHEFLPKCH 676 K+ SCK + + KMHI H KCH Sbjct: 15 KSFSCKYCEKVYVSLGALKMHIRTHTLPCKCH 46 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -1 Query: 109 FYRLSFYLLHTISDIPVRSPSAFYC 35 + +L +Y ++ I IPV P YC Sbjct: 318 YKKLQYYNINYIEQIPVPVPIPIYC 342 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -1 Query: 109 FYRLSFYLLHTISDIPVRSPSAFYC 35 + +L +Y ++ I IPV P YC Sbjct: 329 YKKLQYYNINYIEQIPVPVPIPIYC 353 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -1 Query: 109 FYRLSFYLLHTISDIPVRSPSAFYC 35 + +L +Y ++ I IPV P YC Sbjct: 329 YKKLQYYNINYIEQIPVPVPIPIYC 353 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -1 Query: 109 FYRLSFYLLHTISDIPVRSPSAFYC 35 + +L +Y ++ I IPV P YC Sbjct: 318 YKKLQYYNINYIEQIPVPVPIPIYC 342 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.8 bits (49), Expect = 1.6 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = -1 Query: 109 FYRLSFYLLHTISDIPVRSPSAFYC 35 + +L +Y ++ I IP+ P YC Sbjct: 107 YKKLQYYNINYIEQIPIPVPVPIYC 131 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.8 bits (49), Expect = 1.6 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = -1 Query: 109 FYRLSFYLLHTISDIPVRSPSAFYC 35 + +L +Y ++ I IP+ P YC Sbjct: 107 YKKLQYYNINYIEQIPIPVPVPIYC 131 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.8 bits (49), Expect = 1.6 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = -1 Query: 109 FYRLSFYLLHTISDIPVRSPSAFYC 35 + +L +Y ++ I IP+ P YC Sbjct: 107 YKKLQYYNINYIEQIPIPVPVPIYC 131 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.8 bits (49), Expect = 1.6 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = -1 Query: 109 FYRLSFYLLHTISDIPVRSPSAFYC 35 + +L +Y ++ I IP+ P YC Sbjct: 107 YKKLQYYNINYIEQIPIPVPVPIYC 131 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 23.8 bits (49), Expect = 1.6 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -3 Query: 242 KIYTNASVFRIRQLVNISKALRQKNEANESFNKIPK 135 K T+ SV +NI K L+QK N K+ K Sbjct: 327 KTLTSISVESNTMFINILKFLKQKYVKNSKLEKVIK 362 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 106 YRLSFYLLHTISDIPVRSPSAFYC 35 Y+ +Y ++ I IPV P YC Sbjct: 106 YKKLYYNINYIEQIPVPVPVPIYC 129 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 106 YRLSFYLLHTISDIPVRSPSAFYC 35 Y+ +Y ++ I IPV P YC Sbjct: 106 YKKLYYNINYIEQIPVPVPVPIYC 129 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 106 YRLSFYLLHTISDIPVRSPSAFYC 35 Y+ +Y ++ I IPV P YC Sbjct: 106 YKKLYYNINYIEQIPVPVPVPIYC 129 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 106 YRLSFYLLHTISDIPVRSPSAFYC 35 Y+ +Y ++ I IPV P YC Sbjct: 106 YKKLYYNINYIEQIPVPVPVPIYC 129 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 106 YRLSFYLLHTISDIPVRSPSAFYC 35 Y+ +Y ++ I IPV P YC Sbjct: 106 YKKLYYNINYIEQIPVPVPVPIYC 129 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 106 YRLSFYLLHTISDIPVRSPSAFYC 35 Y+ +Y ++ I IPV P YC Sbjct: 106 YKKLYYNINYIEQIPVPVPVPIYC 129 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 106 YRLSFYLLHTISDIPVRSPSAFYC 35 Y+ +Y ++ I IPV P YC Sbjct: 106 YKKLYYNINYIEQIPVPVPVPIYC 129 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 106 YRLSFYLLHTISDIPVRSPSAFYC 35 Y+ +Y ++ I IPV P YC Sbjct: 114 YKKLYYNINYIEQIPVPVPVPIYC 137 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 106 YRLSFYLLHTISDIPVRSPSAFYC 35 Y+ +Y ++ I IPV P YC Sbjct: 348 YKKLYYNINYIEQIPVPVPVPIYC 371 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 23.0 bits (47), Expect = 2.8 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -1 Query: 106 YRLSFYLLHTISDIPVRSPSAFYC 35 Y+ +Y ++ I IP+ P YC Sbjct: 106 YKKLYYNINYIEQIPIPVPVPIYC 129 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.8 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -1 Query: 106 YRLSFYLLHTISDIPVRSPSAFYC 35 Y+ +Y ++ I +PV P YC Sbjct: 104 YKKLYYNINYIEQVPVPIPVPIYC 127 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 23.0 bits (47), Expect = 2.8 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -1 Query: 106 YRLSFYLLHTISDIPVRSPSAFYC 35 Y+ +Y ++ I IP+ P YC Sbjct: 323 YKKLYYNINYIEQIPIPVPVPIYC 346 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 22.6 bits (46), Expect = 3.7 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 106 YRLSFYLLHTISDIPVRSPSAFYC 35 Y+ +Y + I IPV P YC Sbjct: 349 YKKLYYNIINIEQIPVPVPVPIYC 372 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/34 (23%), Positives = 18/34 (52%) Frame = +2 Query: 452 SQKKSVCIQLFPNLXTFP*INIRNVVF*FNPIFY 553 S++ ++C L N+ FP + ++F P+ + Sbjct: 187 SEESAICAMLKENMPEFPLYQLSCILFFLIPMVF 220 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 21.8 bits (44), Expect = 6.4 Identities = 11/41 (26%), Positives = 18/41 (43%) Frame = -1 Query: 157 NHLTKFQSRLKNTGCVFYRLSFYLLHTISDIPVRSPSAFYC 35 N+ + + N C + +Y ++ I IPV P YC Sbjct: 95 NYKYNYNNNNYNNNC---KKLYYNINYIEQIPVPVPVPIYC 132 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.4 bits (43), Expect = 8.5 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -1 Query: 94 FYLLHTISDIPVRSPSAFYC 35 +Y ++ I IPV P YC Sbjct: 107 YYNINYIEQIPVPVPVPIYC 126 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.4 bits (43), Expect = 8.5 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -1 Query: 94 FYLLHTISDIPVRSPSAFYC 35 +Y ++ I IPV P YC Sbjct: 107 YYNINYIEQIPVPVPVPIYC 126 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = +2 Query: 395 VVVLFNTSWILSRYYLPFYSQKKSVC 472 V VL N SW L + FY C Sbjct: 244 VYVLVNGSWSLPGFVCDFYIAMDVTC 269 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 21.4 bits (43), Expect = 8.5 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -1 Query: 94 FYLLHTISDIPVRSPSAFYC 35 +Y ++ I IPV P YC Sbjct: 345 YYNINYIEQIPVPVPVPIYC 364 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,981 Number of Sequences: 438 Number of extensions: 4097 Number of successful extensions: 35 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -