BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0597 (343 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g04240.1 68416.m00448 O-linked N-acetyl glucosamine transfera... 70 4e-13 At3g11540.2 68416.m01408 gibberellin signal transduction protein... 49 7e-07 At3g11540.1 68416.m01407 gibberellin signal transduction protein... 49 7e-07 At3g49850.1 68416.m05450 myb family transcription factor contain... 27 4.3 At5g49900.1 68418.m06179 expressed protein contains Pfam domain ... 26 5.7 At5g33380.1 68418.m03963 hypothetical protein 26 5.7 At5g17030.1 68418.m01996 UDP-glucoronosyl/UDP-glucosyl transfera... 26 7.6 At4g24580.1 68417.m03522 pleckstrin homology (PH) domain-contain... 26 7.6 At2g20320.1 68415.m02373 DENN (AEX-3) domain-containing protein ... 26 7.6 >At3g04240.1 68416.m00448 O-linked N-acetyl glucosamine transferase, putative similar to O-GlcNAc transferase, Homo sapiens [SP|O15294], Rattus norvegicus [SP|P56558]; contains Pfam profile PF00515: TPR Domain; identical to cDNA GI:18139886 Length = 977 Score = 70.1 bits (164), Expect = 4e-13 Identities = 32/60 (53%), Positives = 42/60 (70%) Frame = +3 Query: 3 RNEIFALIPAPVQVMWLGYPGTSGASYMDYLVTDAVTSPVGTCQPIQRETSVHATHVFLV 182 RNEIFA+ PAP+QV ++G+PGT+GA+Y+DYLVTD SP+ I E VH H + V Sbjct: 682 RNEIFAMQPAPIQVSYMGFPGTTGATYIDYLVTDEFVSPLQYAH-IYSEKLVHLPHCYFV 740 >At3g11540.2 68416.m01408 gibberellin signal transduction protein (SPINDLY) identical to spindly GB:AAC49446 (GI:1589778) [Arabidopsis thaliana]; contains Pfam profile PF00515 TPR Domain Length = 732 Score = 49.2 bits (112), Expect = 7e-07 Identities = 24/51 (47%), Positives = 30/51 (58%) Frame = +3 Query: 27 PAPVQVMWLGYPGTSGASYMDYLVTDAVTSPVGTCQPIQRETSVHATHVFL 179 PAPVQV W+GYP T+G +DY +TD++ P T Q Q E V FL Sbjct: 402 PAPVQVTWIGYPNTTGLPTVDYRITDSLADPPDTKQK-QVEELVRLPDCFL 451 >At3g11540.1 68416.m01407 gibberellin signal transduction protein (SPINDLY) identical to spindly GB:AAC49446 (GI:1589778) [Arabidopsis thaliana]; contains Pfam profile PF00515 TPR Domain Length = 914 Score = 49.2 bits (112), Expect = 7e-07 Identities = 24/51 (47%), Positives = 30/51 (58%) Frame = +3 Query: 27 PAPVQVMWLGYPGTSGASYMDYLVTDAVTSPVGTCQPIQRETSVHATHVFL 179 PAPVQV W+GYP T+G +DY +TD++ P T Q Q E V FL Sbjct: 584 PAPVQVTWIGYPNTTGLPTVDYRITDSLADPPDTKQK-QVEELVRLPDCFL 633 >At3g49850.1 68416.m05450 myb family transcription factor contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 295 Score = 26.6 bits (56), Expect = 4.3 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +3 Query: 102 DAVTSPVGTCQPIQRETSVHATHVFLVAITS 194 DA + P G+C+P + TSV + L AITS Sbjct: 105 DAPSPPAGSCEPPRPSTSV--DKIILEAITS 133 >At5g49900.1 68418.m06179 expressed protein contains Pfam domain PF04685: Protein of unknown function, DUF608 Length = 957 Score = 26.2 bits (55), Expect = 5.7 Identities = 13/56 (23%), Positives = 22/56 (39%) Frame = +1 Query: 121 WELASPYSEKLAYMPHTYFWWRSXANGSTFTKTADSERQKLNPPTIWEWXGQWCWD 288 W+L P E + + + + S ANG ++ KL+ G W W+ Sbjct: 115 WQLFPPKCEDEPVLANQFSAFVSRANGKKYSSVLCPRNPKLDKQDSESGIGSWDWN 170 >At5g33380.1 68418.m03963 hypothetical protein Length = 154 Score = 26.2 bits (55), Expect = 5.7 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +1 Query: 184 RSXANGSTFTKTADSERQKLNPPTIWEWXGQWCWD*PEP 300 R +GS +R+K +PPTI E G D PEP Sbjct: 14 RGDIDGSQSDTKPLLQRRKSHPPTIGEAGGSSWQDAPEP 52 >At5g17030.1 68418.m01996 UDP-glucoronosyl/UDP-glucosyl transferase family protein similar to UDP glucose:flavonoid 3-o-glucosyltransferase from Vitis vinifera, EMBL:AF000372 Length = 459 Score = 25.8 bits (54), Expect = 7.6 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +3 Query: 30 APVQVMWLGYPGTSGASYMDYLVTDAVTSPVG 125 A ++ W+ Y G S +L TDA+ VG Sbjct: 131 AEMKASWVAYYGGGATSLTAHLYTDAIRENVG 162 >At4g24580.1 68417.m03522 pleckstrin homology (PH) domain-containing protein-related / RhoGAP domain-containing protein contains Pfam domain, PF00620: RhoGAP domain Length = 902 Score = 25.8 bits (54), Expect = 7.6 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -3 Query: 74 PASSRIPEPHYLDRGWYQSEN 12 P SS++ PH LDRG +SEN Sbjct: 861 PDSSKLQSPHILDRG--RSEN 879 >At2g20320.1 68415.m02373 DENN (AEX-3) domain-containing protein contains Pfam domain PF02141: DENN (AEX-3) domain Length = 976 Score = 25.8 bits (54), Expect = 7.6 Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +3 Query: 195 QWFHLYKNR*F*TTKVKSPNNLGMARAMVLGL-TRTXWGPLXENWPXKKK 341 QW+ L+ ++ TK+K P +L +++GL T P+ E + +KK Sbjct: 315 QWYQLHSSKALDQTKLKEPASL-FEHFIIVGLHPETNLRPVEEAFRRRKK 363 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,234,663 Number of Sequences: 28952 Number of extensions: 175305 Number of successful extensions: 381 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 379 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 379 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 409426656 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -